Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G039886-GRMZM2G119316
Species:maize
Duplication type:WGD
Function (paralog1):dnaJ subfamily B member 5
Function (paralog2):hypothetical protein LOC100382308

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.6234821103416
Log2 mRNA fold difference:1.5612800925946
Log2 TE fold difference:-0.89165499654336
Sequences
Protein sequence

MGLDYYKILGVDKGATDDDLKKAYRKLAMKWHPDKNPNNKKEAENKFKQISEAYEVLSDP
QKRAVYDQYGEEGLKGQVPPPGAGGAGPGGATFFSTGGDGPTVFRFNPRNAEDIFAEFFG
GSSPFGGMGGGGMGGSGMGGGMPGMRSGGTRFSSSIFGDDIFGSAFGGGPDGHGMHAGGR
AVKAPAIERKLPCSLEELYKGTTKKMKISREISDASGKTIPVEEILTIDVKPGWKKGTKI
TFPEKGNETPNTIPADLVFIIDEKPHPVFTRDGNDLVVTQKIPLAEALTGYTAHVTTLDG
RSLTVPISSVIHPGYEEVVRGEGMPIPKDPSRKGNLRIKFDIKFPARLTADQKSGVKRLL
GQ*

MRYFELDFQYPIGSKRRRSCLCSVHIRLTSLEESWELLPLPEASALVARPGSSPPGLLYP
DASHFPFCLLPSPPPYQTNLTESQLARTVKTPKRARARQPKRRSAKEGRKEASKAAAMGL
DYYKILGVDKGATDDDLKKAYRKLAMKWHPDKNPNNKKEAENKFKQISEAYDVSVLSDPQ
KRAVYDQYGEEGLKGQVPPPGAGGAGSTFFSTGGDGPTVFRFNPRNADDIFAEFFGGSSP
FGGMGGSGMPGMRAGGSRFSSSIFGDDMFGSAFGGGGPDGHGMHTGGRAVKAPAIERKLP
CSLEELYKGTTKKMKISREIADASGKTMPVEEILTIDVKPGWKKGTKITFPEKGNETPHT
IPADLVFIIDEKPHPVFTRDGNDLVVTQKVPLAEALTGHTARLATLDGRILTVPISSVIH
PGYEEVVRGEGMPVPKDPSRKGNLRIKFDIKFPARLSADQKSGVKRLLGQ*

Other information
Ka divergence:0.628571KaKs divergence:0.670932
GC content 1 (%):65GC content 2 (%):63GC content divergence:-0.016
Length 1 (bp):1089Length 2 (bp):1413Length divergence:0.129
MFE 1 (kcal):-516.3MFE 2 (kcal):-612.52MFE divergence0.085