Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G039895-GRMZM2G059266
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383733
Function (paralog2):LOC100281389

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.24839147799119
Log2 mRNA fold difference:0.25649361373172
Log2 TE fold difference:-0.076075351439966
Sequences
Protein sequence

MACDGAARGRPPKRPASGGLAQPNVVTYKRRRRGTGANAGHSAVTSGPDPAEMSAVVHAI
DSQQGGRQTLGRHWRNWRDTLEGVLQSTAGKQGSGGIQSCIRAALRFSGCPPTEHGNLAH
DGGAGRDDPVGAVHSEENSGALVQLEDGTAAPLEANKTMCHNALFDILISEKFAMLCDLL
AATFHVSKPDDVIGLQIIDAKMRNGDYAQNHALLDHDIKQIWKKFEHVGQEMAGLASSLS
VISQASHQKQASGVSEIDVAEHKIEETSLVGVARKALRELTPQCDSGYSTIPKRAGRSGS
DGICKDCGRKADSKGRIICDRCEAAYHVSCLKLAIDEEAPAKWYCPSCVEPDVALKHKNH
GRSHEGCDVCEWLVVKPEEPAEDVSEPELAVKTQESSVSSMGEDSEPDLSTTALANLCKN
CGTCEDEDRKFMVCGHGLCSFKFYHVLCLKERQIASEKQKNLKCWYCPSCLCRRCFKDKD
DEKIVLCDGCDEAYHIYCMDPPCESVPRGKWFCTRCSARRSVQGMQRYEKSILEKVKRAP
GANGPKVQASAGPEK*

MASDGAPRGRRPKRPASGGLVQPDVLTYKRRRRGTGANAGHSAVTSGPDPDPVKNQMSAV
VHATNSQQGGRQTLDRHWRSWRDTLEGVLRSTAVNQSAGGIQNCIRDALRYNGWHPTEHG
NLVDDRGTDEEDATGALHSEESSGALVKLEDGTVASLEANKAMCHDTLFDILISEKFAML
CDLLAATFHGSKPDDVIGLQIIDAKMRNGDYAQNPALFDHDIKQIWKKFEHVGQEMAGLA
SSLLLISQASNQKQASDISEIDVAEHKIEETSLVGVTRKALRKFTPPCDSGYSTIPRRTG
TSGSDGICKDCGRKADSKGRIICDRCEAAYHVSCLKLAIDEEAPAKWYCPTCVEPDVPLK
SNNHGRAHEGCDVCEWLEVEKPEEPAEEPELAVKTQESSVSSIVEDSEPDLSITALANLC
KLCGTCEDENKKFVVCGHGYCSFKFYHALCLKESQIASEKQRNLKCWYCPSCLCRRCFKN
KDDEKIVLCDGCDEAYHTYCMDPPRSSVPRGKWFCTPCSAWRSANGMQRYEKSILQSVKR
VPDAKGPKVQAAAAAPGK*

Other information
Ka divergence:0.0560057KaKs divergence:0.261692
GC content 1 (%):53GC content 2 (%):52GC content divergence:-0.01
Length 1 (bp):1668Length 2 (bp):1677Length divergence:0.003
MFE 1 (kcal):-635.4MFE 2 (kcal):-588.56MFE divergence-0.038