Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G039993-GRMZM2G063438
Species:maize
Duplication type:TD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:2.6762659934647
Log2 mRNA fold difference:1.5940677770936
Log2 TE fold difference:0.7082500738204
Sequences
Protein sequence

MPMRIERDLHMATGNGETSYTKNSRIQEKAMFQMKSVLEEATRAVCTALLPQTMVVADLG
CSSGPNTLRFVTEVTRIIAHHCKLEHNRRHDHPPQLQFFLNDLPGNDFNNLFQLIEQFNK
SSTTHKGDAATEALQPPCYISGLPGSYYTRIFPSESVHLFHSLFCLQWRSQAPEQLKGTQ
KSCLDIYITKTMSPSMVKLFQHQFQKDFSLFLRLRYEELVSGGQMVLTFIGRKHEDVFAG
ESNHLYGLLAQSLKSLVDEGVVEKEKLESFYLPIYSPSVGEVEAIVKQLGLFNMNHVKVF
EINWDPYDDSEGDDVHNSIESGENVAKCLRAVMEPLVASQFGERILDKLFKEYARRVAKH
LETEKTKHAVLVLSIEKAIIHV*

MPMTIERDLHMATGNGETSYTKNSRIQEKVMFQIKPVLEEATRAAYSALLPRTMVVADLG
CSSGPNTLRFVSEVIGIIARHCKEHDRRHDYPQLQFFLNDLPGNDFNNLFLLIQQFNKSM
ARNHKGEAAEALPPCYISGLSGSFYTRIFPSESVHLFHSLFSVHWHSQASEQLKDTKNKC
LDIYITKNMPPSMVKLFQQQFEKDFSLFLKLRYEELVSGGQMVLTFIGRKHEDVFTREPN
HLHGLLAQSLKSLVDEGLVEKEKLESFYLPFYSPSVGEVEAILKQVGLFNMNHVKVFEIN
WDPYDDSESDDVHNSIGSGENVAKCLRAVMESLVASQFGEHILDKLFKEFAHCIAEHLEN
EKTKHVVLVLSIEKAIIHV*

Other information
Ka divergence:0.261121KaKs divergence:0.230592
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1149Length 2 (bp):1140Length divergence:-0.004
MFE 1 (kcal):-369.6MFE 2 (kcal):-340.12MFE divergence-0.042