Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G039996-GRMZM2G092427
Species:maize
Duplication type:WGD
Function (paralog1):chlorophyll a-b binding protein CP24
Function (paralog2):chlorophyll a/b-binding apoprotein CP24 precursor

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.83882377594531
Log2 mRNA fold difference:-0.41681042675705
Log2 TE fold difference:1.4135196660726
Sequences
Protein sequence

MALASTSATAPAAVLKTPFLGARRALANAAAPKPAPRRALLAVAAAAAKKSWIPAFKSDA
EFINPPWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGI
PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAENF
ANFTGDQGYPGGKFFDPLGLAGTVKDGVYVPDVEKLERLKLAEIKHARIAMLAMLVFYFE
AGQGKTPLGALGL*

MALAPTSAAVLKTPFLGARRALANAAAKPAPRRALVVAAAAAAKKSWIPAIKSDAEIVNP
PWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGIPWFEA
GADPSAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQAVEWATPWSRTAENFANFTG
EQGYPGGKFFDPLGLAGTVKDGVYIPDVDKLERLKLAEIKHARIAMLAMLAFYFEAGQGK
TPLGALGL*

Other information
Ka divergence:0.281841KaKs divergence:0.0400972
GC content 1 (%):70GC content 2 (%):70GC content divergence:0
Length 1 (bp):762Length 2 (bp):747Length divergence:-0.01
MFE 1 (kcal):-380.51MFE 2 (kcal):-375.4MFE divergence-0.007