Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G040017-GRMZM2G143356
Species:maize
Duplication type:WGD
Function (paralog1):LOC541635
Function (paralog2):hypothetical protein LOC100384161

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.96157228134813
Log2 mRNA fold difference:-2.0728258907067
Log2 TE fold difference:1.1149896445917
Sequences
Protein sequence

MMMETPQIEMGGFKVNSPQVPNGVLRPTVSSSWNSRGTVERALKSIRIVIFTSKLNLLMP
FGPASIILHFTTRRHGLIFLFSMLGITPLAERLGYATEQLAIYTGPTVGGLLNATFGNAT
EMIIAVYALKNGMIRVVQQSLLGSILSNMLLVMGCAFFAGGVVHRNKDQIFSKATAVVNS
GLLLMAVMGLMFPAVLHFTHSEVRQGASEVALSRFSSCIMLVAYASYLYFQLSGRSNIYS
PIGSEEAPIEDIAEEDEEAEIGMWEAVTWLAVLTLWVSFLSEYLVNAIEGASDSLNLPVA
FISVILLPIVGNAAEHASAIMFAMKDKLDITLGVAIGSSTQISMFVIPFCVVIGWMMGQR
MDLNFQLFETATLFITVLVVAFMLQDGTANYLKGLMLILCYLIVAASFFVHVDPQSSDG*

METPQVEMGGFKVNSPQVPNGGLRPTVSSSWNSQGTVERALRSIRIVIFTSKLNLLMPFG
PASIILHFTTRRHGLVFLFSMLGIMPLAERLGYATEQLAVYTGPTVGGLLNATFGNATEM
IIAIYALKNGMIRVVQQSLLGSILSNMLLVMGCAFFAGGIVHRNKDQVFSKATAAVNSGL
LLMAVMGLMFPAVLHFTHSEVRQGASEVALSRFSSCIMLVAYASYLYFQLSGRSNIYSPI
GSEEAPSEDNPEEDEEAEIGMWEAVTWLAVLTFWVSFLSEYLVNAIEGASDSLNLPVAFI
SVILLPIVGNAAEHASAIMFAMKDKLDITLGVAIGSSTQISMFVIPFCVVIGWTMGQKMD
LNFQLFETATLFITVLVVAFMLQDGTANYLKGLMLILCYLIVAASFFVHVDPQSSEG*

Other information
Ka divergence:0.179272KaKs divergence:-0.0140105
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1260Length 2 (bp):1254Length divergence:-0.002
MFE 1 (kcal):-410.58MFE 2 (kcal):-419.14MFE divergence0.01