Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G040030-GRMZM2G052423
Species:maize
Duplication type:WGD
Function (paralog1):LOC542099
Function (paralog2):cold acclimation protein COR413-PM1

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-4.362410700342
Log2 mRNA fold difference:-3.7990095271422
Log2 TE fold difference:-0.34345669337946
Sequences
Protein sequence

MGKGFASYLAMKTGPEGGDAAAAQQALIDADLRELGVAARKLANHAFVLGGGLGFGTSFL
KWLAFLAAVYLLILDRTNWKTNMLTALLVPYIFFTLPNVLFSLIRGEVGKWIAIIAVILR
LFFPRHFPDWLELPGSIILLTVVAPSLFADSFRGDLVGVFICLVIGCYLLQEHIKASGGF
RNAFRKGNGVSNSIGILLLFIYPVWAGVLQVL*

MGKGFPSYLAMKTGPEGGDGAAAAAQQALIDADLRNLGVAARKLANHAFVLGGGLGFGTS
FLKWLAFLAAVYLLILDRTNWKTNMLTALLVPYIFFTLPNVLFSLIRGEVGKWIAIIALI
LRLFFPRHFPDWLELPGSIILLTAVAPSLFAHTFRDDLVGVFICLAIGCYLLQEHIRASD
GLRNAFRKGNGVSNSIGILLLFIYPVWTGVLQIL*

Other information
Ka divergence:0.774274KaKs divergence:0.818946
GC content 1 (%):57GC content 2 (%):58GC content divergence:0.009
Length 1 (bp):639Length 2 (bp):645Length divergence:0.005
MFE 1 (kcal):-260.2MFE 2 (kcal):-249.62MFE divergence-0.021