Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G040382-GRMZM2G131020
Species:maize
Duplication type:WGD
Function (paralog1):CUE domain containing protein (LOC100283432), mRNA
Function (paralog2):CUE domain containing protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.20996426407284
Log2 mRNA fold difference:0.42480912690009
Log2 TE fold difference:-0.21034048787876
Sequences
Protein sequence

MSAVVCGKRSSSIFADELLPPSPTSPHSSHQPAPKRSRRSPSHRGSSDGHRREALVHHLL
LLFPDMDPQLLEKALEASGDDLDSAIKSLNLLRLESAEAILSSTGFNENGQHTAIQPPVE
GIPNGGVDTTTEHHPTVDNYQTSKNGSEWVELFVREMTNASDIDDARARASRALEALEKS
IVERAGAEATQNLHKENMMLKEQLTVVLRENAVLKRAVAIQHERQKEFDERSHEVQSLKQ
LVLQYQEQVRTLEINNYALTMHLKQAQQSSSIPGRFNPDVF*

MSAVVCGKRSSSIFADELLPPSPSSPHSSHQPAAKRSRRSPSHRGGSDGLRPEALVDYLL
ALFPDMDPQLLEKALEASGDDLDSAIKSLNLLRLESAEAILSSTGFKPENCLQTAIQPSL
EGIPNGGVDTATEHPPSVDNYQTSYNGSEWVELLVTEMRNASDINDARARASRALEALEK
TIVERAGAEATQNLHKENMMLKEQLTVVLRENSVLKRAVAIQHERQKEFDERSHEVQNLK
QLVLQYQEQVRTLEMNNYALTMHLKQAQQNSSIPGRFNPDVF*

www.000webhost.com

Other information
Ka divergence:0.32343KaKs divergence:0.235685
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):846Length 2 (bp):849Length divergence:0.002
MFE 1 (kcal):-282.54MFE 2 (kcal):-292.22MFE divergence0.017