Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G040493-GRMZM2G057698
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100274956

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.4427214652514
Log2 mRNA fold difference:-1.4949009850735
Log2 TE fold difference:-0.90328964263926
Sequences
Protein sequence

MATPNGPSASPMVYPVYLSGVFPQQGGDDQAQGPGIYAIQQNQLAAAMGMGCYAPTTLIP
LTYNIPTESIGAPAGEENVQDARQQNVPQRQVVVRRFHFAFQLDLTLIF

MSAPNGPAACPMVYPVYLTGAFPQQAGDDQAQGPGIYAIQQNQLAAAMGMGCYAPTTLIP
LAYNIPTESVGASAGEENVQDARQQNGPQRQVVVRRFHFAFQLDLALIIKLAAVVFLFSQ
EGSKQRLFLLILFASFIYLYQTGAITPFLRRLQRAGGAAAHPPQAPARVENRAPLPAQND
GNEQPNGPANPDQAAENHEQDAAAGNENPQEAEVEGNRRNWLGGVLKEVQLVVVGFVASL
LPGFQHND*

www.000webhost.com

Other information
Ka divergence:-0.121146KaKs divergence:-0.474833
GC content 1 (%):50GC content 2 (%):52GC content divergence:0.02
Length 1 (bp):327Length 2 (bp):747Length divergence:0.391
MFE 1 (kcal):-107.92MFE 2 (kcal):-255.53MFE divergence0.406