Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G040515-GRMZM2G105523
Species:maize
Duplication type:WGD
Function (paralog1):pyrrolidone-carboxylate peptidase (LOC100281916), mRNA
Function (paralog2):hypothetical protein LOC100276484

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:3.5995127086725
Log2 mRNA fold difference:1.7136181423118
Log2 TE fold difference:1.8709687682566
Sequences
Protein sequence

MDTRGLPKGLVLGSCTVLEAAGQGALGPLYQLLESTVVSGRGRGMPAQERVILLHFGANS
GSHRFALENRAVNEATFRCPDELGWKPQRTPIISSDGNILHARQTTLPLKEISKSLQQMG
YDVMPSDDAGRFVCNYVYYHSLKFAEKHGITSLFVHFPLFLAIDEEVQMQFVASLLEVLA
SLNF*

MGSEGPSPVTVHVTGFKRFHGVAENPTERIVRGLQPFMETRGLPKGLVLGSCTVLEAAGQ
GALGPLYELLESTVSGRERQERVILLHFGANSGSHRFALENQAVNEATFRCPDELGWKPQ
RTPIISSDGSILHARQTTLPVEEISKSLQQMGYDVVPSDDAGRFVCNYVYYHSLKFAEKH
GIGSLFVHFPLFLAIDEEVQMQFVASLLEVLASLNFQ*

Other information
Ka divergence:-0.75596KaKs divergence:-0.826333
GC content 1 (%):53GC content 2 (%):55GC content divergence:0.019
Length 1 (bp):555Length 2 (bp):654Length divergence:0.082
MFE 1 (kcal):-199.5MFE 2 (kcal):-241.7MFE divergence0.096