Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G040736-GRMZM2G392101
Species:maize
Duplication type:WGD
Function (paralog1):RR6 - Corn type-A response regulator
Function (paralog2):cytokinin response regulator2

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.37516942457626
Log2 mRNA fold difference:-0.73564846765075
Log2 TE fold difference:0.70930069169125
Sequences
Protein sequence

MAAAAAAPASVAPSSPKAAGDNRKTVVSVDASELEKHVLAVDDSSVDRAVIARILRGSRY
KVTAVESATRALELLALGLLPDVSMIITDYWMPGMTGYELLKRVKESAALRGIPVVIMSS
ENVSTRITRCLEEGAEGFLLKPVRPADVSRLCSRIR*

MAAAATATPSVAPEAGDRKAVAPPVDAVDLDLELELEEKHVLAVDDSSVDRAVIAKILRS
SKYRVTTVDSATRALELLALGLVPDVNMIITDYWMPGMTGYELLKHVKESSALRAIPVVI
MSSENVPTRISRCLEEGAEDFLLKPVRPADVSRLCSRIR*

Other information
Ka divergence:-0.350738KaKs divergence:-0.999953
GC content 1 (%):67GC content 2 (%):68GC content divergence:0.007
Length 1 (bp):471Length 2 (bp):480Length divergence:0.009
MFE 1 (kcal):-205.31MFE 2 (kcal):-242.5MFE divergence0.083