Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G041028-GRMZM2G481222
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100192845
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:3.0399796158263
Log2 mRNA fold difference:4.0789218500735
Log2 TE fold difference:-1.0597879856762
Sequences
Protein sequence

MAAVVRGVLRGIKEKGLTNFIRDVRDEGYFKCLLDGNLLQTKIHNIGATLVGVDKFGNKY
YEKLHDTQYGRHRWVEYAEKGRYNASQVPAEWHGWLHHITDSTGDKLLNQKTARYLVEHK
QNYSGEGEELIYHSKGHALNPGQRDWTRYQPWEPKKEQA*

MLQLLNQKTARYLVAHKQNYSGEGEELIYHSKGHALNPGQRDWTRYQPWEPKKEQA*

Other information
Ka divergence:0.341005KaKs divergence:-0.998594
GC content 1 (%):50GC content 2 (%):53GC content divergence:0.029
Length 1 (bp):480Length 2 (bp):171Length divergence:-0.475
MFE 1 (kcal):-158.73MFE 2 (kcal):-52.5MFE divergence-0.503