Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G041141-GRMZM5G811633
Species:maize
Duplication type:WGD
Function (paralog1):ubiquitin-protein ligase
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.8663693551118
Log2 mRNA fold difference:-1.9037400701164
Log2 TE fold difference:0.094534375296522
Sequences
Protein sequence

MPGSVPLGLCLDTAGVQVPWYFRCPISLELMRDPVTVSTGQTYDRASIESWVATGNTTCP
VTRTALADFTLIPNHTLRRLIQEWCVAHRSMGVERIPTPKQPADPDLVRSLVAQGPGLPA
LRRLRALARESDKNRLVMATHETRAALVEAAFGSGSGSGAASEELETEAMAVLALVGLGE
AEAAEVVGREERVARLGKVLGGGGPLEARVNAGAVVEAVASASGAEARAALGGAEGVMDG
LVALAEEEKANNARAVRVGVRALFALCLAKENRARAVAAGAAAALARRVAEGGAGEPERA
LAAVERLCRAEGGRDAVVAGAGGGPAAVAALVRAMSGRGAEHAAGALAAVVVGAGGSEAL
QAEAVRAGAMGRLLLMVQGGCSERAKRKAQHLLKLLRSAWPSADCVANSDDFLQHYHY*

MPASVPLCLGLDTAGVQVPWYFRCPISLELMRDPVTVSTGQTYDRSSIESWVATGNTSCP
VTRAPLADFTLIPNHTLRRLIQEWCVAHRSMGVERIPTPKQPADPDLVRSLVAQGPGLPA
LRRLRALARESDKNRLVMATHETRAALLEAAFGSGSGAASEELEAEAMAVLALVGLGEEE
AVEVVGREERVARLGKVLAGGGSLEARVNAGAVVEAAALASGADARAVLGAAEGVMAGLV
TLVEEKASARAGGCSERAKRKAQHLLKLLRSAWPTTDCTANSDDFLQHY*

Other information
Ka divergence:0.0632216KaKs divergence:0.438944
GC content 1 (%):77GC content 2 (%):73GC content divergence:-0.027
Length 1 (bp):1257Length 2 (bp):870Length divergence:-0.182
MFE 1 (kcal):-762.3MFE 2 (kcal):-492.6MFE divergence-0.215