Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G041369-GRMZM2G042677
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.3528748092821
Log2 mRNA fold difference:-1.9581786063498
Log2 TE fold difference:2.3318569804491
Sequences
Protein sequence

MSCSDLEARLTEEYRPSVPHCGAMKGKRWFGLWKNSSELLSRDYMQCFEEQMSLVYDPDI
NEYRNLAGVETRVPNFGSTRAFSYKNPLKSDWCLGKLRAALEDMGYRDGDTMFGAPYDFR
YAPPSPGQTSEVYSRYFKELMELVEAASERTRKKAVILGHSFGGMVALEFVRNTPPAWRR
EHIERLVLVAPTLPGGFLEPVRNFASGTDILYVPATTPLATRAMWRSFESAIVNFPSPAV
FGRLQAPLVVTRERNYSASAQDMERFLAAVGSGEAAEPFRRRAVPKMSSFAAPMVPMTYI
SGVGNRTPLRLVFWGDDIDAAPEAVAYGDGDGKINLISVLAFEKEMRRQPEQKKQFKSIK
INKAQHSTIVTDDFALHRVIQEIVEANNQKIPS*

MASSLLQQLLSLLLLLLPSPLRLREHLSGNHPVSANNFHPIFLVAGMSCSDLEARLTEEY
RPSVPHCGAMKGKGWFGLWKNSSELLSRDYMQCFEEQMSLVYDPDINEYRNLAGVETRVP
NFGSTRAFSYKNPLKSLVPRKAESRTGRHGIPRRRHHVRSPYDFRYAPPSPGQTSEVYSR
YFKELLELVEAASERTRKKAVILGHSFGGMVALEFIRNTPPAWRREHIERLVLVAPTLPG
GFLEPVRNFASGTDIHYVPATTPLATRAMWRSFESAIVNFPSPAVFGRLQAPLVITRERN
YSASAQDMERFLAAVGSGEAAEPFRRRAVPKMSSFAAPMVPMTYISGVGNRTPLRLVFWG
DDFDAGPEAVAYGDGDGKINSISGLAFEKEMRRQPEQKKQFKSIKINKAQHSTIVTDDFA
LHRVIQEIVEANNQKIPS*

www.000webhost.com

Other information
Ka divergence:0.859931KaKs divergence:-0.999319
GC content 1 (%):63GC content 2 (%):63GC content divergence:0
Length 1 (bp):1182Length 2 (bp):1317Length divergence:0.054
MFE 1 (kcal):-535.92MFE 2 (kcal):-584.5MFE divergence0.043