Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G041381-GRMZM2G151826
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274138
Function (paralog2):hypothetical protein LOC100273666

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:2.0146745984153
Log2 mRNA fold difference:0.22791572845506
Log2 TE fold difference:1.7953439699229
Sequences
Protein sequence

MAGRGKAIGAGAAKKATSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYL
AAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELTKLLGGATIASGGVMPNIHQHLLPK
KAASSKASVDDDDN*

MAGRGKAIGAGAAKKATSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYL
AAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELTKLLGGATIASGGVMPNIHQHLLPK
KAGSSKASTVDDDDN*

Other information
Ka divergence:-1KaKs divergence:-0.987805
GC content 1 (%):64GC content 2 (%):64GC content divergence:0
Length 1 (bp):405Length 2 (bp):408Length divergence:0.004
MFE 1 (kcal):-169.1MFE 2 (kcal):-171.41MFE divergence0.007