Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G041424-GRMZM2G053485
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100275813
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.83335717437325
Log2 mRNA fold difference:0.36417648341453
Log2 TE fold difference:0.67968973640367
Sequences
Protein sequence

MAAASLLGPYTGGSGLGGRLVHARSGGRRPAAAVKRLLSRLRRSWRRRAARPRRTAVRFG
YDLHSYYQNFDDGTASCAHHRL*

MAAVSLLGPYTGGSGLGGRLVHARSGGRRPAAAVKRLLSRLSRSWRRRAARPRRTAVRFG
YDLHSYYQNFDDGSAPCAHHRL*

Other information
Ka divergence:1KaKs divergence:1
GC content 1 (%):70GC content 2 (%):69GC content divergence:-0.007
Length 1 (bp):249Length 2 (bp):249Length divergence:0
MFE 1 (kcal):-121.3MFE 2 (kcal):-121.7MFE divergence0.002