Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G041462-GRMZM2G034113
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):homeodomain-leucine zipper transcription factor TaHDZipI-1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEGDDDGPEWMMEVGGAGATGKGKGGALDKNKKRFSEEQIKSLESMFATQTKLEPRQKLQ
LARELGLQPRQVAIWFQNKRARWKSKQLERDYSALRDDYDALLCSYESLKKEKHTLLKQL
EKLAEMLHEPRGKYSGNADAAGAGDDVRSGVGGMKDEFADAGAAPYSSEGGGGGKFAHFT
DDDVGALFRPSSPQPSAAGFTSSGPPEHQPFQFHSGCWPSSTEQTCSSSQWWEFESLSE*

MDGAEDDGTEWMMHGAGGKGKGGGALDKNKKRFSDEQTKSLESMFATQAKLEPRQKLQLA
RELGLQPRQVAIWFQNKRARWKSKQLEREYSALRDDYHALLCSYESLKDEKRALLKQLEK
LAEMLHEPPQGKYYGGNADDVRSGGVGGTKEEEESTDACAGAALYSSECAGGGRFIAHFL
ADDDVGAALFRPPSSPQPTAGLLTSSGPPEHQPFQFHSGCCWPSSSAEQTCSGSQWWELE
SLSE*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):68GC content 2 (%):68GC content divergence:0
Length 1 (bp):720Length 2 (bp):735Length divergence:0.01
MFE 1 (kcal):-343.2MFE 2 (kcal):-382.9MFE divergence0.055