Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G041645-GRMZM2G414995
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.3770002082255
Log2 mRNA fold difference:3.5400476117117
Log2 TE fold difference:-2.8976095802336
Sequences
Protein sequence

MSAHLTVALLLAVAAASARGSDVPSFPLSQAQSPSNSSSPSNASSPPCHLDLSAELFGGV
AAACGASGGPGSLDRGRCCPVLAAWLFAAHARTALSVPPAPAPSAVAGEEGLGPGDDGPM
VPYDNQRCVDALGAALEKRGVALPRPNATCDTVLCFCGIRLHQIGSLRCPAAFAVGAGAG
AAAKNATPTAAVKGLEKSCRNASYAGCSRCVQSLQKLKGNVSREVSGAGGDRARRMLGRD
CQLMGLTWLLAKNKTAYIPTVSAVLRAMLYTARPTEAAGAAPRCSPDQENMPLAVDSLQF
ERAGSTTGSAAANATPRGALLLSLALGLTIGRWDDAFL*

MWAHLAVALFVALAVAPPARGSDVPSFPLSQAQSPSNSSSPSNAASRPCHLDLSAELFGG
VAAACGAGGGPGSLDRGRCCPVLAAWLFAAHARTALSVPPAPPPSALAGDEGMGPDGGDD
GPMVPYDNQRCVDALGAALERRGVALPRPNATCDTVLCFCGIRLHQIGSLRCPAAFAVKA
GAAARNATPTAAVKALEKSCRNASYAGCSRCVQSLQKLKGNVSREVSGAGGDRARRMLGR
DCQLMGLTWLLAKNKTAYIPTVSAVLRAMLYTARPTESGSGGAAPRCSPDQENMPLAVDS
LQFERTASAGGSAAAASATPRGATAAALLGLALSLAVGRWWDAFL*

Other information
Ka divergence:0.243856KaKs divergence:0.0430108
GC content 1 (%):74GC content 2 (%):75GC content divergence:0.007
Length 1 (bp):1017Length 2 (bp):1038Length divergence:0.01
MFE 1 (kcal):-545.83MFE 2 (kcal):-569.2MFE divergence0.021