Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G041770-GRMZM2G162443
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.35440957964694
Log2 mRNA fold difference:0.061139600052237
Log2 TE fold difference:-0.48711667672463
Sequences
Protein sequence

MVSQAPVAGASLAASLCKKSNRVARVLAYALLEWILIALLLANGVFSYLISRFAAFFGLA
PPCALCSRLGVDSLFETRPPHHRGAEPLRRLLCDAHAAELSRLGYCSAHRRLADAGDMCE
DCAAAAAPGKALLSWMGRSELGERDLACACCGVALESGFYSPPFLLTTSAPRGSDCGLKQ
EEEAAMPNGDVVVVSKEGPVIELFDDKPFVEDDSIGVLAAEVVANVERPVALESIDSLVV
TMGTVSSQSGGEGKEAVDHGVVRQNNVDMENTVSSNEEKIMPSDDKVDVVDRLIDEQIVA
VVLVPACIEATLDGGINADKTVDAFADHQSLEDDSGLEVKDQKISFEDEVFEGEQAEQVT
QQQELCAMPTDPSDHEFVERLDRSTELEHFPLAESKHKMNSMPVEASKHVAVTQIEGKQV
QQAEVNQELDSIPKCSREHADEELQGERTAQAGLEQECDSVPIDYGEHGSLTSYAHTDDE
QDEAMQKVTSVTRIEEKQVQQAEVNQELDSIPKCSREHADEELQGERTAQAGLEQECDSV
PIDSGEHGCLTSYAHTDDEQDEAKQKVTSVTRIEEMQVQQAEVNQELDSIPKRSREHADQ
ELEVERTAQAGLEQECDSVPIDSEEHGCLFSYAHTDDEQDEVKQKVTSETADVLHYAADT
FNVNTNSWKEDIEEDSTEAALTAIHQICYEPLTSIVKFSLDHSVSEEDREPDTPTHIEGI
CDSQELLDSKAVVSDAKSVDSSVATLSTDLESTELVSVDQLKSALASTRKSLNTLYSELE
NERNAAAIAADETMAMINRLQEQKAAMQMEAIQYQRLMEEQSEYDQEALQRLNELVVKRE
KEKQDLERELELYRHKVHLYEVKVRKLSRHKADDQNGSSSTSSSAEDSDDLSQSFYEGDE
SSHGINGSNGSIPTDVVLQETARHLVTLDGSLADFEEERLSILEQLKVLEDKLFDLDDEE
SDNMKHFSEENHLSGASNGFSDDDSCFKLHDKRKNVTYRGKKLLPLFDDATVEAGNVPQG
NDAQHSTEVTLDLAREQHKLAIANEIDQVHERLHALEADREYIKQCVRTLKKGGKGFDLL
QEILQHLRDLRRIEQRASARNSGELSPHYLHHHTD*

MVSQAPMAGAGAGAGANLTAALCRKSNRVARVLAYALLEWVLIALLLADGVFSYLISRFA
AFFGLAPPCALCSRLGVDSLFETHPRHRGVGAEPLRRLLCDVHAAELSRVGYCSAHRRLA
DAGDMCEDCAAAAAAAPGKALLSWMGQSELGERDLACACCGVALESGFYSPPFLLTASAP
RGSDCGHKEEEEAARPNGDVVFVSEEGPVIELFDEKPFVEGDSIGVLACGAEVVANVERL
VPLESIDSLPVAMATMLSQSGVEGKEAVDHDDVRQNNVDMEHTVSTDEETIVMTSDDDKV
DDVVDRLIDEHIAAVVFVPACIESTPNDGINAGKTVEAFAFADHQSAEDDSGLKDKDQKI
SDISEDEQAEQATPQQELCAMPTNPSDHEIVERLDRSIDLEHFPQAKSKHKMNSMPVEAS
EHVTVTQIEEKQVQQAEVTQELDSLPICSREQAEVTQAGLEQDCGSVPIDSGEHGCLTSY
AHTDVEQAEVKQKVTSVTRDVLDYAAGTFNVNTNTWKEDIEEDPTEAALTAIYQISYEPL
TNLDKFSPDHSVSEEDRQLNALTHIEDICDSQEPLDSKAAVSDAKSVDSGVATLSTDLES
TELVNADQLKSALASTRKSLNTLYFELENERNAAAIAADETMAMINRLQEQKAAMQMEAI
QYQRLMEEQSEYDQEALERLNELVVKREKEKQDLERELELYRHKVHLYEIKVRKMSRHKA
DDQNGSSSTSSSAEDSDDLSQSFYEGDESSHGLNGSNGSIPTDVVLQETARHLVIIDGSL
ADFEEERLSILEQLKVLEDKLFDLDDDDESDSRKHFPEENHFSGASNGFSDDDSCSKLRD
KRRVVTYRGKELLPLFDDATTVEAGNVPNGDEAHHPAEATLDLARERHKLVIANEIDQVN
ERLQALEADREYIKQCVRALKRGGEGFDLLQEILQHLRDLRRIEQRGRNSGELSPHYLHL
YTD*

www.000webhost.com

Other information
Ka divergence:0.244466KaKs divergence:-0.0469463
GC content 1 (%):49GC content 2 (%):52GC content divergence:0.03
Length 1 (bp):3348Length 2 (bp):2892Length divergence:-0.073
MFE 1 (kcal):-1169.82MFE 2 (kcal):-1066.65MFE divergence-0.046