Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G041774-GRMZM2G173965
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.9847333669976
Log2 mRNA fold difference:-0.071530774548707
Log2 TE fold difference:1.899997758643
Sequences
Protein sequence

MTTTTTAKQLRRVRTLGRGASGAVVWLASDEASGELVAVKSARAAGAAAQLQREGRVLRG
LSSPHIVPCLGSRAAAGGEYQLLLEFAPGGSLADEAARSGGGRLAERAIGAYAGDVARGL
AYLHGRSLVHGDVKARNVVIGGDGRARLTDFGCARPAGGSTRPVGGTPAFMAPEVARGQE
QGPAADVWALGCMVVELATGRAPWSDVEGDDLLAALHRIGYTDDVPEVPAWLSPEAKDFL
AGCFERRAAARPTAAQLAAHPFVVASASAAAAIRGPAKQEVVPSPKSTLHDAFWDSDAED
EADEMSTGAAAERIGALACAASALPDWDTEEGWIDLQDDHSAGTADAPPAPVADYFISWA
EPSDAELEPFVAVAAAAGLPHVAGVALAGATAVNLQGSYYYYPPMHLGVRGNEIPRPLLD
HHGDGLEKGQGSHRVCNRETEKVTMKRISLKRRAAFLLDQHHVRSLDKLEYRPRHDRMLR
RRQSIYRSNSVLGYDVSKGRQVRWRRAVCIAVAA*

MTTKQLRRVRTLGRGASGAVVWLASDEASGELVAVKSARAAGAAAQLRREGRVLRGLSSP
HIVPCVGARAAAGGEYQLLLEFAPGGSLADAAARGGGRLAERDIRAYAGDVARALAYLHG
RSLVHGDVKARNVVVGGDGRARLTDFGCARPAAAGSARPFGGTPAFMAPEVARGEGQGPA
ADVWALGCTVVELATGRAPWGDADGLLAAVHRIGYTDDVPEAPAWMSADARDFLARCFER
RAAARPTAAQLLAHPFVADLDARPKRQEEGLPSPKSTLQQDAFWDSDTDDEADEVATGAA
ERIGALACAASALPDWDSDLQDGWIDLQHDRPGTAGAPQAATTEAAAAVADCFVWAELPD
AEVEQLVATAADASSSGHGHLRRLPRIAGVVAVAGATTTIEQGSYLPMHSGVHEKKKNPR
PFDHGDDGIENAGSHRACNMNRAITMKRISFKKNSFWFVGTHRTTLHMMPKA*

Other information
Ka divergence:0.0392555KaKs divergence:0.123418
GC content 1 (%):70GC content 2 (%):72GC content divergence:0.014
Length 1 (bp):1545Length 2 (bp):1419Length divergence:-0.043
MFE 1 (kcal):-823.42MFE 2 (kcal):-779.86MFE divergence-0.027