Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G041818-GRMZM2G162405
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276272
Function (paralog2):hypothetical protein LOC100193110

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.49875778858452
Log2 mRNA fold difference:-1.5232192572717
Log2 TE fold difference:1.0099042787761
Sequences
Protein sequence

MASDQQALPVPVPVPVPPNPNPTAPADLTPPSASAARKLPIKRRSPRPSSSPPSSSSPAS
SDPLRAPGGGGGSDQQQPPFKFQRIWSESDELRFLQGLLGCGTQGLVFPRDLNVFYDRFS
ESMPQPYTRAQLSEKLRRLKNKFRSMSARVAGGIDPARLAPHDRDVLHLCSRLWDPANAA
TSPFAASAGTSGNKRRRSNPRGTPPDASGDSNSHDYNGISSSAPGLFPDGSNGEDTFYLE
QESGQLGNHEGAALVADSKFDVVVQEQPEAVVTLPNGNNGIGSEMSAECKTVVPCSNEHR
MANAVLDVFEECLREAKSNGIINGGNVESELSKRWRAQRMDELDVLSRRLRLLVEYAAAA
GH*

MASDQQALSVPVPVPVPSNPNPSALADPTPPSASAPRKLPIKRRSPRPSSSPPSSSPDSS
DPLRAPAAGGGGGGSDKQQQPPFKFQRIWSESDELRFLQGLLGCGAQGLVFPRDLNVFYD
RFSESMPQPYTRAQLSEKLRRLKNKFRSMSARVAEGLDPARLAPHDRDVLHLCSRLWDPA
NAATSPFVASAGTSGNKRRRANLQGTSLPPPDASGDSNSHDYNGINSSAPCLFPDGSNGE
DMFYLEQEPGHLGDHEGAAPVADSRFGVIVQEQGVIVHEQGEAVGTLPNGNNGIGNEMNV
ECKMVVPCSNEHRMANAVLDVFEECLREAKSNGVINGGNVDGSGEESELSKRWRAQRMDE
LDVLSRRLRLLVEYAAAAGQ*

www.000webhost.com

Other information
Ka divergence:0.20022KaKs divergence:0.445893
GC content 1 (%):65GC content 2 (%):63GC content divergence:-0.016
Length 1 (bp):1089Length 2 (bp):1143Length divergence:0.024
MFE 1 (kcal):-470.74MFE 2 (kcal):-483.8MFE divergence0.014