Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G042047-GRMZM2G151726
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193816
Function (paralog2):hypothetical protein LOC100194327

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.873134584248
Log2 mRNA fold difference:1.02706861793
Log2 TE fold difference:0.84845160038715
Sequences
Protein sequence

MAGRGKAIGSGAAKKAMSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYL
AAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELSRLLGTVTIASGGVMPNIHNLLLPK
KSGGGSAKAAAGDED*

MAGRGKAIGSGAAKKATSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYL
AAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELSRLLGTVTIASGGVMPNIHNLLLPK
KAGGGSAKAAAGDED*

Other information
Ka divergence:0.00203666KaKs divergence:-0.311258
GC content 1 (%):65GC content 2 (%):64GC content divergence:-0.008
Length 1 (bp):408Length 2 (bp):408Length divergence:0
MFE 1 (kcal):-186MFE 2 (kcal):-177.02MFE divergence-0.025