Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G042146-GRMZM2G051630
Species:maize
Duplication type:TD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100274318

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.41863417911422
Log2 mRNA fold difference:0.27867526535481
Log2 TE fold difference:0.14274781458288
Sequences
Protein sequence

MADAKQQQQQQQQPQQAAAAATGVWKTVKPFVNGGASGMLATCVIQPIDMVKVRIQLGEG
SAGQVTRNMLANEGVRSFYKGLSAGLLRQATYTTARLGSFRVLTNKAVEKNEGKPLPLFQ
KAFIGLTAGAIGACVGSPADLALIRMQADSTLPVAQRRNYKNAFHALYRISGDEGVLALW
KGAGPTVVRAMALNMGMLASYDQSVELFRDKFGAGEISTVVGASAVSGFFASACSLPFDY
VKTQIQKMQPDANGKYPYTGSLDCAVKTFKSGGPFKFYTGFPVYCVRIAPHVMVNREYLA
IHSWTVHLLPYFSIW*

MADAKQQQQQPQQAAAAATGVWKTVKPFVNGGASGMLATCVIQPIDMVKVRIQLGEGSAG
QVTRNMLANEGVRSFYKGLSAGLLRQATYTTARLGSFRVLTNKAVEKNEGKPLPLIQKAF
IGLTAGAIGACFGSPADLALIRMQADSTLPAAQRRNYKNAFHALYRISADEGVLALWKGA
GPTVVRAMALNMGMLASYDQSVELFRDKFGAGEISTVVGASAVSGFFASACSLPFDYVKT
QIQKMQPDANGKYPYTGSLDCAVKTFKSGGPFKFYTGFPVYCVRIAPHVMMTWIFLNQIQ
KFEKKIGI*

Other information
Ka divergence:-0.884739KaKs divergence:-0.86123
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):948Length 2 (bp):927Length divergence:-0.011
MFE 1 (kcal):-340.8MFE 2 (kcal):-335MFE divergence-0.009