Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G042173-GRMZM2G418604
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100194141

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.3603631264035
Log2 mRNA fold difference:-1.8025533314277
Log2 TE fold difference:0.45335924264956
Sequences
Protein sequence

MFCANYAKLPWAECQQYLLKCFLKVHKGKYSQVHLIALLTASLSRYHDDFAVAVVDEVLE
EIRVGLELNDYGMQQRRLAHMRFLGELYSYKHIDSSVVFDTLYLIIVFGHGTPEQDVLDP
PEDCFRIRLIITLLQTCGHYFSKGSSKRKLDKFLLHFQRYIISKGPLPLDIEFDIQDLFG
ELRPNMSRYLSIEELVAALVELEENERSAPVEKVENERHSDNESHKRQARDAGPSVNGGS
AANGIEENGKDHEIADSESYSDSGSIDGREDEDILSEDKSNDGSDNEGDDEDDGIPVGSD
EDENVEVRQKVMKVDPKEQEDFDRELKALLQESLESRKSEARSRLPLNMMVPMNVLEGSS
KDSRATESESGEETVDEEGGNAGGSSKVRVKVLMKKGHKQQTRQMLIPADSSIVRSTKQQ
EAAELEEKQSIKRRILEYNEREEEELNGASQMGNWGQGATNTSSIRSGGRGSWDGSARGG
GRQRHHIAGSGGFYHSYGRRR*

MDELKSVNLSKFVSEAVSYICEAKLRSADIQAAVQVCSLLHQRYKDFSPCLIEGLLKIFF
PGKSGDDLDADKNSRAMKKRSTLKLLIELYFVGIVEDASIFVNIIKDLTSAEHLKDREGT
QTNLSLLSTFARQGKFFVGLQPHGQEAYDEFFKDLNVTAEQKKFFKKALNSYYDAVAELL
QSEHASLRLMEAENAKVLSAKGELSDENTSSYEKLRKSFDQLLRGVSSLAESLDMQPPVM
PDDGNTTRVTTGTDALPSSGKESSALEPIWDDEDTKAFYESLPDLRAFVPAVLLGEVEPK
SNEQHVKGRELSGESTSEQETELHDNVPTSATERQLEVKVDDLVKESEDRDKEKGKDGEK
EKSKEKDLDKKNEREKEKGRVLDGASLDNLLQRLPGCVSRDLIDQLTVEFCYLNSKANRK
KLVRALFNVNRTSLELLPYYSRLVATLSTCMKDVPSMLLSMLEEEFNFLINKKDQINIET
KIKNIRFIGELCKFKMAPPALVFSCLKACLDDFSHHNIDVACNLLETCGRFLYRSPETTI
RMANMLEILMRLKNVKNLDSRHSTLVENAYYLCKPPERSARISKVRPPLHQYIRKLLFSD
LDKSSVEHVLRQLRKLPWAECQQYLLKCFLKVHKGKYSQVHLIALLTASLSRYHDDFAVS
VVDEVLEEIRVGLELNDYGMQQRRLAHMRFLGELYSYKHIDSSVVFDTLYLIIVFGHGTP
EQDVLDPPEDCFRIRLIITLLQTCGHYFSKGSSKRKLDKFLLHFQRYIISKGPLPLDIEF
DIQDLFGELRPTMSRYSSIEELVAALVEFEENERSAPVEKVENERHSDNESQKRHSRDAG
PSVNGESAANGTEENGKAHEVADSESYSDTGSIDGREEEEDILSEDKSNDGSDNEGDDED
DGIPVVSDEDENVEVRQKVMNVDPKEQEDFDRELKALLQESLESRKSEARSRLPLNMMVP
MNVLEGSKDSRATESESGEETVDEEGGNAGGSSKVRVKVLMKKGHKQQTRQMLIPADSSI
VQSTKQQEAAELEEKQSIKRRILEYNEREEELNGASQMGNWGQGATSTSSIRSGGRGSWD
GSARGGGRQRHHITGSGGFYHSYGRRR*

Other information
Ka divergence:0.0219344KaKs divergence:-0.262368
GC content 1 (%):45GC content 2 (%):42GC content divergence:-0.034
Length 1 (bp):1506Length 2 (bp):3324Length divergence:0.376
MFE 1 (kcal):-450.26MFE 2 (kcal):-984.19MFE divergence0.372