Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G042250-GRMZM2G109987
Species:maize
Duplication type:WGD
Function (paralog1):rolled leaf 2
Function (paralog2):rolled leaf1

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.59270312234563
Log2 mRNA fold difference:-0.17514908531625
Log2 TE fold difference:-0.41737607862994
Sequences
Protein sequence

MAAAVAMRGGSSDSGGFDKVPGMDSGKYVRYTPEQVEVLERLYIDCPKPSSSRRQQLLRE
CPILSNIEPKQIKVWFQNRRCRDKQRKESSRLQAVNRKLTAMNKLLMEENERLQKQVSQL
VHENAHMRQQLQNTSLANDTSCESNVTAPPNAIRDASNPSGLLAIAEETFTEFLSKATGT
AIDWVQMPGMKPGPDSVGIVAISHGCRGVAARACGLVNLEPTKVIEILKDRPSWFRDCRS
LEVFTMFPAGNGGTIELIYMQMYAPTTLVPARDFWTLRYTTTMEDGSLVVCERSLTGSGG
GPNAASAQQFVRAEMLPSGYLVRPCEGGGSIVHIVDHLDLEAWSVPEVLRPLYESSRVVA
QKMTTVALRHLRQIAQETSGEVVYALGRQPAVLRTFSQRLSRGFNDAISGFNDDGWSVMG
GDGIEDVVVACNSTKKIRNNSNAGITFGAPGGIICAKASMLLQSVPPAVLVRFLREHRSE
WADYNIDAYLASSLKTSACSLPGLRPMRFSGGQMIMPLAHTVENEEILEVVRLEGQPLTH
DEALLSRDIHLLQLCTGIDEKSVGSSFQLVFAPIDEHFPDDAPLISSGFRVIPLDMKTDG
VSSGRTLDLASSLDVGSAAPQASGDAPPDDCNLRSVLTIAFQFPYEMHLQDSVATMARQY
VRSVVSAVQRVSMAISPSQSGLNAGQRMLSGFPEAATLARWVCQSYHYHLGVELLNQSDE
AGEALLKMLWHHPDAVLCCSFKVPEELYSSPQYSNLLKQRQIPLTRETYVYVCKQGRARH
VRNISYCAARPDARQDLRRVRKESNILRYLKTNGTGLRVPAVGRVHVRNGSACLIRPSCS
VEGARRGQQRPLPGVLLRQLVLRLTRHPMACVMSRPIFLYGDPNMGKPSAVTEGFMLHAL
VVRLESSVFMKKLDTAQ

MGTMVAAVALRGGSSDSGGFDKVPGMDSGKYVRYTPEQVEVLERLYIDCPKPSSSRRQQL
LRECPILSNIEPKQIKVWFQNRRCRDKQRKESSRLQAVNRKLTAMNKLLMEENERLQKQV
SQLVHENAHMRQQLQNTSLANDTSCESNVTTPPNPIRDASNPSGLLAIAEETFTEFLSKA
TGTAIDWVQMPGMKPGPDSVGIVAISHGCRGVAARACGLVNLEPTKGIEILKDRPSWFRD
CRSLEVFTRFPAGNGGTIELIYMQMYAPTTLVPARDFWTLRYTTTMEDGSLVVCERSLSG
SGGGPNAASTQQFVRAEMLPSGYLVRPCEGGGSIVHIVDHLDLEAWSVPEVLRPLYESSR
VVAQKMTTVALRHLRQIAQETSGEVVYALGRQPAVLRTFSQRLSRGFNDAISGFNDDGWS
VMGGDGIEDVVIACNSTKKIRNTSNAGITFGAPGGIICAKASMLLQSVPPAVLVRFLREH
RSEWADYNIDAYLASSLKTSACSLPGLRPMRFSEGQMIMPLAHTVENEEILEVVRLEGQP
LTHDEALLSRDIHLLQLCTGIDEKSVGSSFQLVFAPIDEHFPDDAPLISSGFRVIPLDVK
TDGVSSGRTLDLASSLDVGSAAPQASGESPDDCSLRSVLTIAFQFPYEMHLQDSVAAMAR
QYVRSVISAVQRVSMAISPSQSGLNAGHRMLSGFPEAATLARWVCQSYHYHLGMELLNQS
DGAGEALLKMLWHHPDAVLCCSFKEKPMFTFANKAGLDMLETSLVALQDLTLDKIFDESG
RKALFSDISKLMEQGYAYLPSGVCMSGMGRHVSFDQAVAWKVLGEDSNIHCLAFCFVNWS
FV*

Other information
Ka divergence:-0.662874KaKs divergence:-0.502278
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):2751Length 2 (bp):2529Length divergence:-0.042
MFE 1 (kcal):-964.14MFE 2 (kcal):-891.9MFE divergence-0.039