Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G042538-GRMZM2G368765
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:2.1612200267179
Log2 mRNA fold difference:-0.14168138477071
Log2 TE fold difference:2.2395687899215
Sequences
Protein sequence

MASTAIPSPPPPAVPERRVPLVPRLADDGGGGVMGDARGSSAGGSGSGSVAGISPSILII
AVIVVVMLLASLCIHYFIRHLCRHAGPAVSSSPSSRQAPPLPLVAHPAAVASVAAADGQG
AGGGKAAEAERLIARLPLFTLSSSLASVPKSSRDCAVCQSAFRDDDELRLLPACRHAFHS
RCVDPWLRGNPSCPLCRASIALPCPPLTDLLRVELGSVSSRRSNPDAAAAAVRAYPLPGG
LPNSESSEYLVEEELQVVLKRSPRAAAGSSDPPSQQQQNQLAAVERGQPSSSSSVGLTPT
ASFRSTAERWSSRWSNRWSSRWSSGRWSSRYDAGTVTAAATAEWWWDMDGGVAPATRRRD
ADDGSASFYGFVRWLTGAY*

MASTAIPSPPPPAVPERRVPLVPRLADDGGGDGRGDARGSSAGGGGSGSGSVAGISPSIL
VIAVIVVVMLLASLCIHYFIRHLCRHVGPAGSSSSSSSLSRQAPPLPLVARPAAGASVAP
ADGQGGGGKAAAAAEAEAERLIARLPQFTLSSSLAAVPKSSRDCAVCQTAFRDDDGLRLL
PACRHAFHSRCVDPWLRANPSCPLCRASIALPHPPLTDLLRVELGSVSSRRSNPDAAAAA
VRAYPLPGGLPDSASSEYLVEEELQVVLKPTPPAAAGSSDPTSQQQQQLAAVERGQPTSS
VGLTPTASFRSTAERWSSRWSNRWSSRWSSGRWSNRYDAGTVTAAATAEWWWDMDGGVAP
PTRRRDADDGSASFYGFVRWLTGAY*

www.000webhost.com

Other information
Ka divergence:0.36442KaKs divergence:0.542176
GC content 1 (%):73GC content 2 (%):74GC content divergence:0.007
Length 1 (bp):1140Length 2 (bp):1158Length divergence:0.008
MFE 1 (kcal):-645.8MFE 2 (kcal):-669.93MFE divergence0.018