Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G042704-GRMZM2G085974
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100277602
Function (paralog2):hypothetical protein LOC100382861

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:4.151586459804
Log2 mRNA fold difference:-1.230766350839
Log2 TE fold difference:5.5183469290356
Sequences
Protein sequence

MVTRYTDCTFLPGRPNHGKNQKSAKVAAIPCTPAAQVGRGAASSEMEEKSSFIWQIDGFS
SLLDKQEGWTNSGYFKIKDLNWYLQLNLKDRKSGDEREYVSLILVLSKTSGLEPDTIVEA
SFKLLIYDQAYGRHSEHEFSHRFQTTESSRSSGISCMILVYTLKEPSSGFIVGDSCVFGV
ELIKFTTAKVKDGSGTLHVQKRIGFCSAREAYTWIINDFLSLKGRCYSPEFEIGGHKWYL
TMYPSGTGIDGDKEILSLYLHMAKPNGDASLQNSGVLVEVSLSIKDKVTSNRKTMTGRCQ
LQATEGEGWGWSNFMATKSVKDWYLVKGSCLIEADVAILGSSKMN*

MGNSSSRGRSEPRQGEQRTMKWSVDGFASLLDKGDGWTYSRVFELMGYNWYLKLNPRDKK
SGDDGTEYVSLVLQLDDLSVKPDTVVKASFKLLIYDQAYGKHSEHQVRHSFQTASTSSGA
SCMVSLEKLKERPSKFIVNNSCTFGVEFIKVKASKVSTTSETLFVRKPSVFDEARTYTWD
IEDFFALKNSGHSPEFEVGGHKWSIGVYTSSDGNHLTLDLCMKNTDGVQHDGSANLVEFS
LAIKHQEGGNHWKATGRSQFTSNARCWGWTKFISLEDFKDSSNGYLVKNKCCIEAEVALV
GSSKMK*

Other information
Ka divergence:-0.0765144KaKs divergence:-0.406612
GC content 1 (%):50GC content 2 (%):55GC content divergence:0.048
Length 1 (bp):1038Length 2 (bp):921Length divergence:-0.06
MFE 1 (kcal):-358.1MFE 2 (kcal):-351.54MFE divergence-0.009