Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G042782-GRMZM2G329119
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.78277507279017
Log2 mRNA fold difference:3.0325164874369
Log2 TE fold difference:-2.3079055551151
Sequences
Protein sequence

MLFLISALLSRGLEDIQADRDDPSQPLVTAPFGHASQEIVNLLLCGEAVPNVFDGKMDLG
GGMSLKGIPNNVEVGFLTLLESLNLCKVGLYLKCPKWPIWVVGSESHYTVLFALNPNVQE
ENELEERESKIRRAFDAQDQSGGGGFISVEGFQQVLRDTDINFPSDKLEDLCNAGIIVWS
EFWQALLQLDKRAGGMKDPTGLMGKKQFTIFHFNGIAKSVLNGNASAGGSCPIQRPRLCK
LNVTVPPRWTQDEYLADVVSASTSSKDDIILSLAPPGQTNQHAPLVDCIRTRWPRAVCSW
VGDVPSIV*

MDLGGGMSLKGIPNNVEVGFLTLLESLNLCKVGQYLKCPKWPIWVVGSESHYTVLFALNP
NVQEENELEERESKIRRAFDAQDQSGGGGFISVEGFQQVLRDTDINFPSDKLEDLCNAGI
IVWSEFWQALLQLDKRAGGMKDPTGLMGKKQFTIFHFNGIAKSVLNGNASAGGSCPIQRP
RLCKLNVTVPPRWTQDEYLADVVSASTSSSKDDSILSLAPPGQTNQHAPLVDCIRTRWPR
AVCSWVGDVPSIV*

Other information
Ka divergence:-1KaKs divergence:-0.999733
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):927Length 2 (bp):762Length divergence:-0.098
MFE 1 (kcal):-297.3MFE 2 (kcal):-245.72MFE divergence-0.095