Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G043109-GRMZM2G081462
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100384675 (LOC100384675), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.4995430627118
Log2 mRNA fold difference:4.407738837968
Log2 TE fold difference:-2.9086016382487
Sequences
Protein sequence

MASSAMELSLVNPAATHRHRGGLVGLPLARRSVVRFRVSAAAAPPKSSGPNKRGKTEIQE
TLLTPRFYTTDFDEMERLFNAEINKQLNQAEFDALLQEFKTDYNQTHFVRNPEFKAAADK
MEGPHRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGFLN
KGLSDFNLALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIFRHLKANPEYQVY
PIFKYFENWCQDENRHGDFFSALLKAQPQFLNDWKAKLWSRFFCLSVTNL*

MASAMELSLLNPAATHRHRGGLAGLPLARRSVVRFRVSASAAAAAPPKSSGPKKRGKTEI
QETLLTPRFYTTDFDEMERLFNAEINKQLNQAEFDALLQEFKTDYNQTHFVRNPEFKAAA
DRMEGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEARHAGF
LNKGLSDFNLALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIFRHLKANPEYQ
VYPIFKYFENWCQDENRHGDFFSALLKAQPQFLNDWKAKLWSRFFCLSVYVTMYLNDCQR
TAFYEGIGLDTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRKLDRMVEINQKIIAVGE
SDEIPLVKNLKRIPLVASLVSEIIAAYLMPPIESGSVDFAEFEPRLVY*

Other information
Ka divergence:-0.253608KaKs divergence:-0.0804598
GC content 1 (%):61GC content 2 (%):59GC content divergence:-0.017
Length 1 (bp):873Length 2 (bp):1227Length divergence:0.169
MFE 1 (kcal):-328.86MFE 2 (kcal):-474.52MFE divergence0.181