Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G043291-GRMZM2G162486
Species:maize
Duplication type:WGD
Function (paralog1):LOC100282747
Function (paralog2):IN2-1 protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.7871230868584
Log2 mRNA fold difference:-1.3732000126536
Log2 TE fold difference:-0.41866364471836
Sequences
Protein sequence

MNSLAFPSCPSALTPASTTAPASSPFPSPRIKIRCPRQEDAAHYHLRLRDRSSSQTVIVA
MAAAAPASSVKEVLPSPLTSASEPPPLFDGTTRLYVAYHCPYAQRAWIARNYKGLQDKIK
IVAIDLADRPTWYKEKVYPENKVPSLEHNNQVKGESLDLVKYIDSNFEGPSLLPEDPSKK
QFAEELLAYTDAFNKALYFCIVSKEDVSEEAVAALDKIEDALGKFNEGPFSLGQFSLVDI
AYVPFIERFQIFYSNIKNYDITKGRPNLQKFIEEVDKIDAYTQTKQDPQFLLEQTKKRLG
IA*

MAAAAPASSVKEVLPSPLTSASEPPPLFDGTTRLYVAYLCPFAQRAWIARNYKGLQDKIK
IVAIDLADRPAWYKEKVYPENKVPSLEHDNQVKGESLDLVKYIDSNFEGPSLLPEDHAKQ
QFAEELLGYTDAFNKAFYSCLVDREDVSEEAVAALDKIEDALGKFNDGPFFLGQFSLVDV
AYVPFIERFQILYSNIKNYDVTKGRPNLQKFIEEVNKIDAYTQTKLDPQFLLEQTKKRLG
IA*

www.000webhost.com

Other information
Ka divergence:0.374971KaKs divergence:0.254527
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):909Length 2 (bp):729Length divergence:-0.11
MFE 1 (kcal):-287.48MFE 2 (kcal):-244.1MFE divergence-0.082