Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G043383-GRMZM2G070542
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272988
Function (paralog2):LOC100282671

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.73186186044422
Log2 mRNA fold difference:0.49412201338797
Log2 TE fold difference:0.22317619727085
Sequences
Protein sequence

MALAFDEFGRPFIILREQEKKTRLRGLDAQKANIGAGKAVARILRTSLGPKGADKMLQSP
DGDVIITNDGATILEQMDVDNQIAKLMVELSRSQDYEIGDGTTGVVVMAGALLEQAEKLL
ERGIHPIRVAEGYEMASKVAFDHLERISEKFEFSADNIEPLVQTCMTTLSSKIVNRCKRA
LAEIAVKAVLAVADLERKDVNLDLIKVEGKVGGKLEDTELVYGIIVDKDMSHPQMPKRIE
DAKIAILTCPFEPPKPKTKHKVDIDTVEKFQTLREQEQKYFDEMVQKCKDAGATLVICQW
GFDDEANHLLMHRNLPAVRWVGGVELELIAIATGGRIVPRFQELSPEKLGKAGLVREKSF
GTTKDRMLYIEQCANSRAVTIFIRGGNKMMIEETKRSLHDALCVARNLIRNNSIVYGGGS
AEISCSIAVETAADRHPGVEQYAIRSFADALDAVPLALAENSGLSPIDTLTAVKAQQVKE
SNPHCGIDCNDVGTNDMKEQNVFETLIGKQQQILLATQVVKMILKIDDVISPSEY*

MALAFDEFGRPFIILREQEKKTRLRGLDAQKANIASAKAVARILRTSLGPKGMDKMLQSP
DGDVIITNDGATILEQMDVDNQIAKLMVELSRSQDYEIGDGTTGVVVMAGALLEQAEKLL
ERGIHPIRVAEGYEMASKVAFDHLEHISEKFEFSADNIEPLVQTCMTTLSSKIVNRCKRA
LAEIAVKAVLAVADLERKDVNLDLIKVEGKVGGKLEDTELVYGIIVDKDMSHPQMPKRIE
DAKIAILTCPFEPPKPKTKHKVDIDTVEKFQTLREQEQKYFDEMVQKCKDAGATLVICQW
GFDDEANHLLMHRNLPAVRWVGGVELELIAIATGGRIVPRFQELSPEKLGKAGLVREKSF
GTTKDRMLYIEKCANSRAVTIFIRGGNKMMIEETKRSLHDALCVARNLIRNNSIVYGGGS
AEISCSIAVETAADRHPGVEQYAIRSFADALDAVPLALAENSGLSPIDTLTAVKAQQVKV
WATLFCSVCTTMLLLFLFAITLGDMITNNTSAGEQPPLWHRLQRRWHHRHERTERLRDPD
WQAATDLACHPGGEDDPEDRRCHLTVRVLTERRNGWLCWICVGGIADVF*

Other information
Ka divergence:0.784499KaKs divergence:0.645949
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):1608Length 2 (bp):1770Length divergence:0.048
MFE 1 (kcal):-563.15MFE 2 (kcal):-627.25MFE divergence0.054