Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G043484-GRMZM5G875502
Species:maize
Duplication type:WGD
Function (paralog1):Histone-lysine N-methyltransferase EZ3 (EC 2.1.1.43)(Enhancer of zeste protein 3)
Function (paralog2):Histone-lysine N-methyltransferase EZ2 (EC 2.1.1.43)(Enhancer of zeste protein 2)

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.25807257991976
Log2 mRNA fold difference:0.63461307736635
Log2 TE fold difference:-0.37798978501798
Sequences
Protein sequence

MASSSKASDSSSQRSKRSDQGTGREAAPASVVPIHGNLTQLIRQIKSRRLLYIKEKLEAN
RKTLQRHSCALFDVAAAAEVASRGSDGGNALSQRAAEGQFRLAGSDLAHGIGERDVVYMQ
EENLASGTLVLSSSGAAAQRTVVRFVKLPLVERIPPYTTWIFLDKNQRMADDQSVVGRRR
IYYDPIGNEALICSDSDEEIPEPEEEKHFFTEGEDQLIWRATQEHGLNREVVNVLCQFID
STPSEIEERSEVLFEKNEKNSGSSDKIERQLSLDKTMDAVLDSFDNLFCRRCLVFDCRLH
GCSQNLVFPSEKQPYSFEPDENKKPCGRQCYLRFPQWREGFQEIHDVGLSGCATYNMESG
TVSHKVDVSIMSESEDSNREKGNIRSMTLVGTSGSKIISSVSAEESTTPPSADTSETENA
SSDMPPSSLRKYKISKRGPRYRERSPGKRQKVFTYDISFASNILNKLSIPEIRDTRLESR
EPGGDKLQILDESTKKTSSKDICGESPITTTENVGRESKKVSSTKNFLEHTLSCWSALER
DLYLKGIEIFGKNSCLIARNLLSGMKTCMEVANYMYNNGAAMAKRPLLNKSISGDFAETE
QDYMEQDMVARTRIYRRRGRNRKLKYTWKSAGHPTVRKRIGDGKQWYTQYNPCVCQQMCG
KDCPCVENGTCCEKYCGCSKSCKNKFRGCHCAKSQCRSRQCPCFAASRECDPDVCRNCWV
SCGDGSLGEPPARGDGYQCGNMKLLLKQQQRILLGRSDVAGWGAFIKNPVNKNDYLGEYT
GELISHKEADKRGKIYDRANSSFLFDLNDQYVLDAYRKGDKLKFANHSSNPNCYAKVMLV
AGDHRVGIYAKEHIEASEELFYDYRYGPDQAPAWARRPEGSKKDEASVSHHRAHKVAR*

MASSSKASDSSQRSKRSDQGMGKDAAAASVVPIHANLTQLIRQVQSGRLAYIKEKLEVNR
KTLQRHSCSLFDVAAAAEVASRGTDGGNALSQRAAERQCGSDLANGIGERDVVSVQEENL
ATGTLALSSSGATAQRTIVRFVKLPLVEKIPPYTTWIFLDKNQRMADDQSVVGRRRIYYD
TVGNEALICSDSDEEIPEPEEEKHFFTKGEDHLIWRATQDHGLNQEVVNVLCQFIGATPS
EIEERSEVLFEKNEKHSGSSDKIESRLSLDKTMDAVLDSFDNLFCRRCLVFDCRLHGCSQ
NLVFPCEKQPYSFDPDENKKPCGHLCYLRFPQWREGFKEMHDDGLAGGATYTMESGTASQ
RVDVNVMYESEDSNRQKGNIRSMTLVGTSGSKIISSVSAEESTTTPSADISETENVSSDL
PPSSLRKHKISKHGPRYREHSPGKRQKVFTSDISFEGNIMNKLSIPEIRDTRLESRESGG
DKLRILDESTKKTSRKDMCGESPATTMENVGRQSNKVSSTKNFLESTLSCWSALERDLYL
KGIEIFGKNSCLIARNLLSGLKTCIEVANYMYNNGAAMAKRPLLNKSISGDFAENEQDYM
EQDMAARTRIYRRRGRNRKLKYTWKSAGHPTVRKRTDDGKQCYTQYSPCACQQMCGKDCP
CADKGTCCEKYCGCSKSCKNKFRGCHCAKSQCRSRQCPCFAASRECDPDVCRNCWVSCGD
GSLGEPLARGDGYQCGNMKLLLKQQQRILLGRSDVAGWGAFIKNPVNKNDYLGEYTGELI
SHKEADKRGKIYDRANSSFLFDLNDQYVLDAYRKGDKLKFANHSSNPNCYAKVMLVAGDH
RVGIYAKEHIEASEELFYDYRYGPDQAPAWARRPEGSKKDEASVSHRRAHKVAR*

Other information
Ka divergence:0.299191KaKs divergence:0.125393
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):2697Length 2 (bp):2685Length divergence:-0.002
MFE 1 (kcal):-887.37MFE 2 (kcal):-892.56MFE divergence0.003