Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G043493-GRMZM2G124567
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100216770
Function (paralog2):hypothetical protein LOC100194178

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.3690762592184
Log2 mRNA fold difference:-1.3619582791869
Log2 TE fold difference:-1.008843757582
Sequences
Protein sequence

MMSRERKKAAALQEKLKILRSITHSHALSNTSIIMDASAYIKELKQKVVRLNQEIACAQD
ALRHKASSYPTAVGPASGDAGIGVHMRRRDRGSPRSAGVVVPGERVLRQELPGAARRRAG
GLRRAGAQRAPGHRVLRRLLPPRGRGRRERGGQRGRARREAGRPAGRQELLRGR*

MPWIIQYTRTRAAEQHIDNHGRVGVHQAAAAEGGEAEPGDCLRAGRPETQVLLLSDGDRG
NPRSAGVPRQRVLRQELPGAARLRPGSLRRAGAQRPPGHRVLRGRLLPPRGCGRGERGGQ
RGRARREAGRPAGRQELPRERLRRRARRRRVARLSARVSRHTRTRLYLHCIGRPLMCQRA
QLDRV*

Other information
Ka divergence:0.921505KaKs divergence:0.97619
GC content 1 (%):64GC content 2 (%):63GC content divergence:-0.008
Length 1 (bp):525Length 2 (bp):558Length divergence:0.03
MFE 1 (kcal):-232.8MFE 2 (kcal):-242MFE divergence0.019