Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G043749-GRMZM2G003642
Species:maize
Duplication type:WGD
Function (paralog1):brain protein 44
Function (paralog2):hypothetical protein LOC100273562

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAATKLQAFWNHPAGPKTIHFWAPTFKWGISIANIADFAKPPEKISYPQQVAVACTGIIW
SRYSLVITPKNWNLFSVNVAMAGTGLYQLSRKIRQDYLSGEKDAAPQLQE*

MAATKLQALWNHPAGPKTIHFWAPTFKWGISIANIADFAKPPEKISYPQQVAVACTGLIW
SRYSLVITPRNWNLFSVNVAMAGTGLYQLSRKIRQDYLSDEKDAASQLEA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):333Length 2 (bp):333Length divergence:0
MFE 1 (kcal):-92.2MFE 2 (kcal):-95.92MFE divergence0.02