Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G043783-GRMZM2G153999
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274461
Function (paralog2):hypothetical protein LOC100384716 (LOC100384716), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.33770461201406
Log2 mRNA fold difference:-0.9051138948026
Log2 TE fold difference:0.58247127579713
Sequences
Protein sequence

MDPAGPRVATDPAGSGAAPPREELDRRGGACSGAAAAEGSASRLAGAGLGDPRAGILESS
GQAEAYLHTCTMDVSQLTAEGVTQCGARVSLLPQIGALQSETPCLTLGRDSSAESMEKLH
GSESLPCCKENIGTVRQPKPDPEHVDNRMSVARLGLDLNTVDSSDAAELNPFFPYKKLGQ
SKVSDPSECGSTTAATAESESHRKWREMKRNGFLSSSHGNAVVPRPRGRPPKRKKDDEFK
RSTSTQHGQANKSVKVAAPSGLLSGLNPGIINHVRNSKQVYSIIKAMVHSERLENEKQPA
FTSQTGGRGREASEGIQDEKYGAGFKKCHMLMKDNNAVFHQALPTTSQFLAQDGDRLKLQ
LSSAVTMSSDRACSTSADDPATNHDYMTVLSVKAASVASQWLELLHQDIRGRLAALKRSR
KRVRNALHTELPYLISTEFSSNQENESSIANTCDAGCTEKAVSEAHVARWRSLFVQMDRA
LQEEGKQLENRLKQVQEMQSNCDKGLKHMSCEAPLLGPIPELWKLKNPDISESEWAVQAA
AASIYSTCNMAMRTENVPCF*

MDLAGPRGATDPAGSRAAPPHEELDGRGGGACSGAAAVEGSAWRLAVAGLGDPRAGVLES
LGQPEAHLHTCTMDVPQLTAEGATQLGDRVSLLHQTGTLQSETPCLTLGRDSNAVSMEKL
HASDCLPCGKENVGTGLQPKSDPERADNRMSVARLGLDLNTVDSPDVAEPNPFFPYKKLG
QSKVSDPSECGSTTGAIEESESHRKWREMKQNGFLSSFHGNAVVPRPRGRPPKRKRDDEF
KKSSSTQHVQANKSVKVAAPSGLLSGLNPGIINHVRNSKQVYSIIKAMVHSERLENENHS
SQTGERGREVNERIQDQKYGGGFMKCHLLINDNNAVFHQTLPNTSQFLAQDGDSLKLQLP
SAVTMSSDRTFSTSADDPASNHDYMTVLSVKAASVASQWLELLHQDIRGRLAALKRSRKR
VRNALHTELPYLTATEFSSNQENESSIANTSEIGCTDKAVSEAHVARWRSLFVQMDKTLQ
EEGKQLENKLKQVQEMQLNCDKGLKHMTCEAPLLGPMAELWKLKNPNISESEWAVQAAAA
SIYSTCNMVMRTENVPCF*

www.000webhost.com

Other information
Ka divergence:0.0149986KaKs divergence:0.10701
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):1683Length 2 (bp):1677Length divergence:-0.002
MFE 1 (kcal):-592.53MFE 2 (kcal):-576.83MFE divergence-0.013