Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G043932-GRMZM2G405662
Species:maize
Duplication type:WGD
Function (paralog1):metal ion binding protein
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-3.0450392373071
Log2 mRNA fold difference:-3.2032206363769
Log2 TE fold difference:0.14986240715846
Sequences
Protein sequence

MAAKKLVLKLDLHDDKDKQKVLKAVSTLHGIDSISVDMKGSNLTVVGLADPVDVVARLRK
VAAAEIVSVGPAKEDKKEGDKKEGDKKKKDDEKKQQVLWYPHPWHAAAAAQQYHPHPYPP
QYAVHSAEEDPNSCAIC*

MAAKKVVLKLDLHDNRDKQKVLKAVSTLHGIDSIAVDMKESKLTVVGLADPVDVVGRLRK
VGSAAIVSVGPATEEKKKDGDKKEGGGDKKDADKKGDDKKPPPPPVYPYPYPWHAYAAAA
AAAQYQYHPRPYPPQYVVHSAEEDPNSCVIC*

Other information
Ka divergence:-0.0936051KaKs divergence:-0.999879
GC content 1 (%):65GC content 2 (%):67GC content divergence:0.015
Length 1 (bp):414Length 2 (bp):456Length divergence:0.048
MFE 1 (kcal):-158.32MFE 2 (kcal):-202.81MFE divergence0.123