Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G044027-GRMZM2G165357
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191862
Function (paralog2):hypothetical protein LOC100193447

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.19696026442336
Log2 mRNA fold difference:-0.12863505242942
Log2 TE fold difference:-0.076189692454014
Sequences
Protein sequence

MAQKETNGSNGEHISTRPPPTPSPLRFSKFFQANLRILVTGGAGFIGSHLVDRLMENEKH
EVIVADNFFTGSKDNLKKWIGHPRFELIRHDVTEPLLVEVDQIYHLACPASPIFYKHNPV
KTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLEHPQTEAYWGNVNPIGVRSCYDE
GKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQAVRGEPLTVQKPG
TQTRSFCYVADMVDGLIRLMNGNNTGPINLGNPGEFTMLELAENVKELINPDITVTMTEN
TPDDPRQRKPDITKAKEVLGWEPKIVLKDGLVLMEDDFRERLAVPKKTKA*

MAQKETNGSNGDHISTRPPPTPSPLRFSKFFQANLRILVTGGAGFIGSHLVDKLMENEKH
EVIVADNFFTGSKDNLKKWIGHPRFELIRHDVTEPLLVEVDQIYHLACPASPIFYKHNPV
KTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLEHPQTEAYWGNVNPIGVRSCYDE
GKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQAVRGEPLTVQRPG
TQTRSFCYVADMVDGLIKLMNGNKTGPINLGNPGEFTMLELAENVKELINPDVTVTMTEN
TPDDPRQRKPDITKAKEVLGWEPKIVLRDGLVLMEDDFRERLTVPKKTKA*

Other information
Ka divergence:0.00215983KaKs divergence:0.188406
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):1053Length 2 (bp):1053Length divergence:0
MFE 1 (kcal):-359.03MFE 2 (kcal):-355.9MFE divergence-0.004