Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G044055-AC155376.2
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192542
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MPSPRQFLQLLLPTLLATCCVDGANGPHAPATARRQLHQPFFVPDQPGQPSAPPPFFPAI
PVTPPPPVPTGQDQPTYPALVFPSNGSSGATPPAGNSHGSKKSSKLVPAILLPLLTVAVL
GLSIAFFFSHRRRNAARGGGGGCVGGGDAKFLHPERTSLFARDEFGGSGGGGVREAAPAP
APASATSAEFLYVGTLASRADERSSDTTSSGDEVSRSSGGSPELRPLPPLARQCAPAPSR
SPGAASPSSGEEEFYSPRGSSTKTSSSRRTLATAVQAALEARDRSRTPSPGSVLSTPSYP
SSPGATLSPAPASPPAFSSPGESGRRSVKSRSESARVVVLPPVPPTPPPPPPFAPTLPPP
PPPRRKPPSPSPPCSPLNDKPALRSSTDTIERNPFAQPPSLPTSTHPPRPPPAAGPPPPP
PPPPPPPVGYWESRVRKPDTSKETRSPALSPPSFRSVPAPTDAFPSWLPESSEQGDKSED
TTPRPKLKPLHWDKVRASSDRVMVWDQLKSSSFQVNEEMIETLFICNPANAPAKEATRRP
VLPTPKAENKVLDPKKAQNIAILLRALNVTKEEVSDALCEGNTENFGADLLETLLKMAPT
KEEEIKLREFKEESSPVKLNPAEKFLKAVLDVPFAFKRVDAMLYIANFDAEVNYLKKSFE
TLEAACDELRSSRLFLKLLEAVLKTGNRMNVGTNRGDAHAFKLDTLLKLVDVKGTDGHTT
LLHFVVQEMIRTEGARVSASTQTTPRTQANPLREELECKRLGLRVVGGLASELGNVKKAA
AMDSDVLSSYVAKLAGGIEKVTEVLRLNEEVKSRDDAWQFHDRMQRFLKKADDEIIRVQC
QESVALSLVKEITEYFHGDSAKEEAHPFRIFMVVRDFLAVLDQVCKEVGRINERTIASSA
RHFPVPVNPMMPQLFPRLHALRAGFSDDESSAASVSSP*

PAPAVGPPPPPPPSPPPPPPPPVGYWESRVRKPDTSKETRSPALSPPPQAANFRSVPAPT
DAFSSRPPESSDQGDKSEDTTPRPKLKPLHWDKVRASSDRVMVWDQLKSSSFQVNEEMIE
TLFICNPANAPAKEATRRPVLPTPRAENKVLDPKKAQNIAILLRALNVTKEEVCDALCEG
NTENFGAELLETLLKMAPTKEEEIKLREFEEETSPVKLNPAEKFLKAVLDVPFAFKRVDA
MLYIANFDSEVNYLKKSFETLEAACDELRSSRLFLKLLEAVLKTGNRMNVGTNRGDAHAF
KLDTLLKLVDVKGTDGHTTLLHFVVQEIIRTEGSRQSASAQTTPRTQANPLREELECKKL
GLQAVAGLANELSSVKKAAGMDSDVLSSYVTKLAGGIEKVTEVVLRLKNEGTESRDGAWR
FHDRMQRFLKKADDEIIRIQCQESVALSLVKEITEYFHGDSAKEEAHPFRIFMVVRDFLA
VLDQVCREVGRVNERTIASSVRHFPVPVNPTTPQLFPRLHALRAGFSDDDDESSAASVSS
P*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):65GC content 2 (%):60GC content divergence:-0.04
Length 1 (bp):2817Length 2 (bp):1626Length divergence:-0.268
MFE 1 (kcal):-1263.85MFE 2 (kcal):-657.28MFE divergence-0.316