Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G044265-GRMZM2G481103
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193962
Function (paralog2):LOC100282361

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.111252721553
Log2 mRNA fold difference:-0.3106441064051
Log2 TE fold difference:-0.77757690430481
Sequences
Protein sequence

MRESINRPPTPSAVEDRDKEPSLVEIINIKFVESGEKEKLTELLRERLVECGWMDEMKAF
CRDYVRKKGRNNVRVDDLIHVIVPKGRASVPASVKAELLQRIRSFMATTLR*

MRASINRPPTPSAEEDRDKQPSLGEIINIKLVETGEKEKLMELLRERLAECGWRDEMKAL
CRAYARKKGRNNVTVDDLIHVITPKGRASVPDSVKAELLQRIRSFLMSTTLR*

Other information
Ka divergence:-0.599017KaKs divergence:-0.673616
GC content 1 (%):51GC content 2 (%):52GC content divergence:0.01
Length 1 (bp):336Length 2 (bp):339Length divergence:0.004
MFE 1 (kcal):-119.57MFE 2 (kcal):-116.2MFE divergence-0.014