Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G044348-GRMZM2G150251
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100217073
Function (paralog2):hypothetical protein LOC100272510

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.9572752492732
Log2 mRNA fold difference:-2.504192665896
Log2 TE fold difference:1.781583791657
Sequences
Protein sequence

MRAHERAASLALACLSLAPLLVNVNPNVNVVLTACLTVYVGCYRSVKPTPPSETMSKEHA
MRFPLVGSAMLLSLFLLFKFLSKDLVNAVLTAYFFILGIVALSATLLPSIKRFLPKEWND
NLIVWRAPFFHSLSVEFTKSQIIASIPGFFFCLWYASKKHWLANNVLGLAFCIQGIEMLS
LGSFKTGAILLGGLFVYDIFWVFFTPVMVSVAKSFDAPIKLLFPTADAERPFSMLGLGDI
VIPGIFVALALRFDVSRGTKKRYFNSAFLGYAVGMTVTIVVMNWFQAAQPALLYLVPGVI
GFVAVPCLWYGEVKQLLEFDESKTESEEGSTEEEQDDDSSKGNKKVE*

MMTHEWAANLALAGLSLAPLVVNVNPNVNVVLTACLTVYVGCYRSVKPTPPSETMSKEHA
MRFPLVGSAMLLSLFLLFKFLSKDLVNAVLTAYFFILGIVALSATLLPSIKRFLPKEWND
NLIVWRAPLFHSLSVEFTKSQIVASIPGFFFCLWYASKKHWLANNVLGLAFCIQGIEMLS
LGSFKTGAILLGGLFVYDIFWVFFTPVMVSVAKSFDAPIKLLFPTADDARPFSMLGLGDI
VIPGIFVALALRFDVSRGIKKRYFNSAFSGYAVGMAVTIIVMNWFQAAQPALLYLVPGVI
GFVAVHCLWYGEVKQLLEFDESKAEAEEGGAEGEQDGDGSKASKKVD*

Other information
Ka divergence:-0.24819KaKs divergence:-0.329211
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1044Length 2 (bp):1044Length divergence:0
MFE 1 (kcal):-327MFE 2 (kcal):-326.5MFE divergence-0.001