Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G044354-GRMZM2G122443
Species:maize
Duplication type:WGD
Function (paralog1):LOC100282809
Function (paralog2):LOC100283315

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.77422056603796
Log2 mRNA fold difference:0.38402325449511
Log2 TE fold difference:0.41514311713064
Sequences
Protein sequence

MGFAGWVSMLLFLLVAGAVANDQIFTTSGVPFGRSSREPSYRVEFHPVDSPFHPENGQES
VPMASHDGKRYKCFLPVEETKTMKSMLPQNATNVIIESERRIKPKEPDELLEVLKDQCFY
RHEGWWSYEFCYHGKIRQVHVDDDKVIQEFVLGEFDDDATAAYHENITSELVDDDHHVKD
ISQRYHVHLYTNGTVCDLTDIPRETEVRFVCSEPTVLISSVKEISSCRYVVTIQSPMLCK
NPLFQEEKRTLSIHCNELPARAESSAEDDSLPKEAQISIIPDQDELHDFPAYAT*

MDFAGRVSVLLFFLVARTVANDQIFTTSGLPFGRSSREPRYRVEFHPVDSPFHPENGQES
VPMASHEGKRYKCFLPVEETKTMKSMLPQNATNIIIESERRIKPKEPDELLEVLKDQCFY
RHEGWWSYEFCYYGKIRQVHVEDGKVIQEFVLGEFDDDATAAYHENSTSELADDDHHVKD
ISKRYHVHLYTNGTVCDLTDIPRETEVRFVCSEPTVLISSVKEISSCKYVVTIQSPMLCK
NPLFQQEKRTLPIHCNELPAKAESGAEDGLLPKEAQISIIPDQDELHGFPAYAT*

Other information
Ka divergence:0.0463389KaKs divergence:0.467825
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):885Length 2 (bp):885Length divergence:0
MFE 1 (kcal):-275.6MFE 2 (kcal):-265.08MFE divergence-0.019