Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G044460-GRMZM2G180372
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382514
Function (paralog2):hypothetical protein LOC100274189 (LOC100274189), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.3424748564621
Log2 mRNA fold difference:-0.65818588858027
Log2 TE fold difference:-1.595588773704
Sequences
Protein sequence

MGACASVHKDPGHPKKQFLDSPTKAKAANGKGGGGGGVAPVGDGFGDLKSKVDAEAEQLR
AEFNPKNPDSGSKDEVFFESRAWLDSDCEDDFYSVNGDFTPSRGSTPVYQPRAQTVMSSI
FQPDTRSSKSPEPSPTGRRKLAELLQEAMQDGPEESADEEEQQQQSLSAAADGKPPVSES
TSSSACSTVPTPVAVAKSRKEKAWYTGRCCLPSFVHSLTLDESERGQKMSSRPCAV*

MGACASVHKDPGYPKEQFLDSPTKAEAANEKGGCGGGDDDFADFKSKVDAEQQRAELNPK
SPDSGSKDEVFFESRAWLDSDCEDDFYSVNGDFTPSRGSTPIHQPRAQTVMSNIFQPDTH
GSKSPEPSPTGRRKLAELLQEAMQNGPEESTDQELQLRSVAADGKPVSESTSSSACSTVT
TPIAVANAKSRKEKAWYTGRCCLPSFVHSLTLDESERAQKMSSRPCAV*

Other information
Ka divergence:0.120553KaKs divergence:0.82639
GC content 1 (%):60GC content 2 (%):57GC content divergence:-0.026
Length 1 (bp):711Length 2 (bp):687Length divergence:-0.017
MFE 1 (kcal):-289MFE 2 (kcal):-254.1MFE divergence-0.064