Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G044527-GRMZM2G330772
Species:maize
Duplication type:WGD
Function (paralog1):syntaxin 132
Function (paralog2):syntaxin 132

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.57309101555834
Log2 mRNA fold difference:-0.084554294402968
Log2 TE fold difference:0.64292803611634
Sequences
Protein sequence

MAHLPASAPAALTLCPPNLFPPAQSILCGATATPSPVPPPSVPRPPLSSPPARLSLPLSP
SLLAAMNNLLTDSFELPRRDSSRDADIEMGMHQADASDNLKDFLKKVDAIESIIAKLSNL
LNKLQTANEESKAVTKASSMKAIKQRMEKDIDEVGKIARQAKTKVDELERDNLSNRQKPG
CGKGSAVDRSREQTTGAVKKKLKERMDDFQTLREAIRQEYREVVERRVFTVTGNRPDEET
IDDLIETGKSEQIFKDAIQHQGRGQILDTVAEIQERHDAVRDLERKLLELQQIFMDMAVL
VEAQGDMINNIETHVSNATNHIQQGVSALQNAKKLQKNSRKWMCYAIILLLVIVAVIVVA
VIQPWKK*

MNNLLTDSFELPRRDSSRDADIEMGMHQADASDNLKDFLKKVDTIESLIAKLTNLLNKLQ
TANEESKAVTKASSMKAIKQRMEKDIDEVGKIARQAKTKVDELEKDNLSNRQKPGCGKGS
AVDRSREQTTGAVKKKLKERMDDFQTLREAIRQEYREVVERRVFTVTGNRPDEETIDDLI
ETGKSEQIFKDAIQHQGRGQILDTVAEIQERHDAVRDLERKLLELQQIFMDMAVLVEAQG
DMINNIETHVSILYFCIEPVVYRISIVFFLCFVIASLMESSHPLFQGLERHQPHTARCER
APEREETAEEFEEVDVLRHHHTAGDSRGHCRRSHPAMEEGHLAWWCLFSCLCNMCAVFFV
GDS*

Other information
Ka divergence:0.786802KaKs divergence:0.559045
GC content 1 (%):49GC content 2 (%):43GC content divergence:-0.065
Length 1 (bp):1104Length 2 (bp):1092Length divergence:-0.005
MFE 1 (kcal):-332.3MFE 2 (kcal):-322.9MFE divergence-0.014