Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G044629-GRMZM2G019986
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279878
Function (paralog2):LOC100282551 (pco144375b), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MKEEMMVGLSAPEPVGRWGAAPPQAMLERMKDYGQEGAFALWDDLSPEDQELLVRDIELG
ILRQSYVVFIPITGIPLPAVEPVPESSVSKVEGRSAEDKERWWKKGLKAISEGKLAVVLL
AGGQGTRLGSSDPKGCFNIGLPSGKSLFQLQAERILCVQKLAAQSSESPSNTVPIHWYIM
TSPFTDAATAKFFETRRYFGLDPDQVTFFQQGTLPCVSADGRFIMETPYRVAKAPDGNGG
VYAALKSKKLMEDMAARGVKYVDCYGVDNALVRVADPTFLGYFIDKGASSAAKVVRKPIE
HSTQQAYPQENVGVFVQRGRGGPLSVVEYSEMDAAMATEMNQSTGRLRYCWSNICLHMFT
LDFLNQVANSLEKDSVYHLAEKKIPSIHGFTTGLKLEQFIFDAFTYSPSTALFEVMREEE
FAPVKNASGATYDTPDSAKLMLLRLHSRWVVAAGGFLTHSVPLYMTGVEVSPLSSYAGEN
LEAICRGRTFHAPSEISF*

MKEEMVVGLSAPGPVGRWGAAPPQAMLERMKDYGQEGAFALWDDLSPEDRELLVRDIESL
DLSRIDRIIRRSLGSQGIPLPAVEPVPESSVSKVEDRSPEDKERWWKKGLKAISEGKLAV
VLLAGGQGTRLGSSDPKGCFNIGLPSGKSLFQLQAERILCVQKLAAQSSESPSNTVLIHW
YIMTSPFTDASTRKFFETRRYFGLDPDQVTFFQQGTLPCVSADGRFIMETPYRVAKAPDG
NGGVYAALKSKKLMEDMAARGVKYVDCYGVDNALVRVADPTFLGYFIDKGVSSAAKVVRK
AYPQENVGVFVQRGRGGPLSVVEYSEMDAAMTTEINQSTGRLRYCWSNICLHMFTLDFLN
QVANSLEKDSVYHLAEKKIPSIHGFTTGLKLEQFIFDAFTYSPSTELFEVMREEEFAPVK
NANGATYDTPDSAKLMLLRLHSRWVVAAGGFLTHSVPLYMTGVEVSPLSSYAGENLEAIC
RGRTFHAPSEISF*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):54GC content 2 (%):56GC content divergence:0.018
Length 1 (bp):1497Length 2 (bp):1482Length divergence:-0.005
MFE 1 (kcal):-568.51MFE 2 (kcal):-578.05MFE divergence0.008