Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G044681-GRMZM2G050647
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100304442
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.9589719350361
Log2 mRNA fold difference:1.6709373951049
Log2 TE fold difference:0.21707051371977
Sequences
Protein sequence

MASDSDVDEDELLQIALQEQAARDLSHQRPPAANKPVVNLVRPPAPNARGGNGRAGGAAA
KARQPSRGGDEDEDSDVELLSISSGEEDDNPRARGPPPPRGGGGGRAGARRAVARDDGDF
DDEEPRSWKRVDEAELARRVREMREAKVAPNIQELDQKAAAAAAAARKALTSVQTLPKGV
EVLDPLGLGVIDNKSLRLITDASVSSPISREKSQGLDPNMRDKVIYSSPSFDPKVFLSWV
HKDTSAADLEAGALTLKTDLKGRTQQKKQLVKENFDCFVSCKTTIDDIESKLRQIEEDPE
GAGTAHLYSVTQKISGVANRAFEPLFERQAQAEKIRSVQGMLQRFRTLFNLPSAIRGNIR
KGEYDLAVREYQKAKSIVLPSHVGILKRVLEEVEKVMQEFRGMLYKSMEDPHLDFAELEN
IVRLLLELEPETDPVWHYLNIQNSRIHGLFEKCTQDHELRMEVLQNKIREKVLSDSKWRQ
LQQDSNKSLEVDSAICDSPRADQLSTNFMAEEADSLRATYTRRLTSVLIQHVPAFWRLAL
SVFSGKFAKTASGNVVSDSDMNAKPSANKNDDKGGDVKYTNHTLDEVASMVRDTISAFDT
KVQSTFRDFEECNILCPYMSDTIKEIAKACQTLEGKDSSPTAVKLLRTLHFQMTKLYVLR
LCSWMRATTKEISKDDTWVILSTLERNKSPYAISCMPLEFRDIIISAMDRIDTMILNLMS
ETAKSYDISQPLQEINESVRLAFLNSFLDFAGYLERFGGELTENRPNNENNYVQNGYING
TRETSANTDGDLHKKLLVVLSNIGYCKAELSEELYTTYRHIWSPVRNNDERSSDMRDLMT
SFSALEEKVLDQYTFAKSNLIRSSAQSYLLDPGIYWGAAPMVKSIRDATLDLLHILVAVH
AEIYSGARPLLEKTMKILVEGLVDIFLSVFHENKTKGIRLLDANGFCQLMLELEYFETVL
HTYFSPEAQQAMKSLQENLLEKACESIAEAMENPGHQRRPTRGSEDASSDDRQPSVSPDD
LLLLAQQYSSDLLQGELERTRLNIACFMESALQSTSAPAGSKPAAYSSYHAQVPQHAPIQ
TSSPSFRRQQTGTSSPVVSRRRR*

MASDSDVDEDELLQIALQEQAARDLSHQRPPAANKPVVNLVRPPAPNARGGNARAGGAAA
KARQPSRGGDEDDDSEVELLSISSGDEDDNPRARGPPPPRGGGGGRAGARRAASRDDGDF
DDEEPRSWKRVDEAELARRVREMREAKVAPNIQELDQKAAAAAAAAARKALTSVQTLPKG
VEVLDPLGLGVIDNKSLRLITDASVSSPISREKSQGLDPNMRDKVIYSSPNFDPKVFLSW
VHKDTSAADLEAGALTLKTDLKGRTQQKKQLVKENFDCFVSCKTTIDDIESKLRQIEEDP
EGAGTAHLYSVTQKISGVANRAFEPLFERQAQAEKIRSVQGMLQRFRTLFNLPSAIRGNI
RKGEYDLAVREYQKAKSIVLPSHVGILKRVLEEVEKVMQEFRGMLYKSMEDPHLDLAEIE
NIVRLLLELEPETDPVWHYLNIQNSRIHGLFEKCTQDHDSRMEVLQNKIREKVLSDSKWR
QLQQDSNKSLEVDSTIGDSPRVDQLSTNFMAEEADSLRATYIRRLTSVLIQHVPAFWRLA
LSVFSGKFAKAASGNVVSDFDVNAKPTANKNDEKGGEVKYTNHTLDEVGSMVQATISAFD
TKVQSTFRDFEECNILCPYMSDTIKEIAKACQTLEGKDSSPTAVKMLRTLHFEMTKLYIL
RLCSWMRATTKEISKDETWVTLSTLERNKSQYAISCLPLEFRDITVSAMDRIDTMILNLM
SETAKSYDISQPLQEINESVRLAFLNSFLDFAGYLERFGGELTENRPNKENNYVSNGYIN
GTRETFVNTDGDLHKKLLVVLSNIGYCKAELSEELYSKYRHIWSPVRNNEERSSDMRDLR
TSFSALEEKVLDQYTFAKSNLIRSAAQSYLLDSGIYWGAAPMVKGIRDATLDLLHILVAV
HAEVYSGARPLLEKTMKILVEGLVDIFLSVFHENKTKDIRLLDANGFCQLMLELEYFETV
LHTYFSPEAQQAMKSLQENLLEKACESVAEAMENPGHQRRPTRGSEDTASDDRQPSVSPD
DLLVLAQQCSSDLLQGELERTRLNIACFMESTLQPTAAPAGPKPAAHSSYQAQHAPVQTS
SPSFRRQQTGTSSPVVSRRRR*

Other information
Ka divergence:-0.176254KaKs divergence:-0.283735
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):3312Length 2 (bp):3306Length divergence:-0.001
MFE 1 (kcal):-1113.36MFE 2 (kcal):-1137.74MFE divergence0.011