Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G044968-GRMZM2G150319
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276406
Function (paralog2):hypothetical protein LOC100192765

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.29764631727849
Log2 mRNA fold difference:0.4412248203665
Log2 TE fold difference:-0.010086470340151
Sequences
Protein sequence

MAVDPRQVVAGFLTLSMFVMLGNMIKHDHFSPVTEEMGLKATGARSNTMKLDNNAEMNSV
DMAGVEDLMDTIEEVKPCWTKPSPKNQPSNGFVTFSLTMGPEYHISQITDAVVVARYLGA
TFVLPDIRGNELGNKRKFQDMYNVDKFVRSLDGVVEVIDEIPDEVSAKKPAVIRVPNRVT
ESFIMDTIQPIFKKNKYLRLAVIFSSVSLRPKETSNKDLDATACLAMFSGLELKHEYSEV
ARKMLDRLQELSKKSDGKVLAIDLRTDLLEKKSCKTTSGARRKGCYNPNEVLAFLRSVGF
SANTTIYLTETWWHKGLNDLKEEFPNTYTKDDIMPAENKGEFLKSSNADLASALDLEICS
QSDVFIPAVAGLFYGHVTGKRIASGRTQIIVPSQSSTSTHASDFTSTYISNKNHLAYTCY
C*

MAVDPRQVVAGFLTLSMFVMLGNMIKHDHFSPVTEELGFEATGVVSNTRKLDNDAEMSSV
DTAGVEDLMDAVEEVKPCWTKPSPKNQPSNGFVTFSLTMGPEYHISQITDAVVIARYLGA
TLVLPDIRGNELGNKRKFQDIYNVDKFVRSLDGVVEVIEDIPDEVSAKKPAVIRVPNRVT
ESFITGTIQPIFQKNKYLRLAVIFSSVSLRPKETNNKDMDATACLAMFGGLELKHEYSEV
ARKMLDRLQELSKKSDGKVLAIDLRTDLLEKKSCKTTRGARRKGCYSPDEVLAFLRSVGF
SANTTIYLTETSWYKGLDVLKEEFPNTWYKGDIMPAENKAEFLKSSNADLARALDLEICS
QSDVFVPAVAGLFYGHVTGKRIASGRTQIVVPSQSSTSTHASDFISTYISNKNHLAYACY
C*

Other information
Ka divergence:0.130227KaKs divergence:-0.080895
GC content 1 (%):46GC content 2 (%):50GC content divergence:0.042
Length 1 (bp):1266Length 2 (bp):1266Length divergence:0
MFE 1 (kcal):-401.2MFE 2 (kcal):-448.08MFE divergence0.055