Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G045259-GRMZM2G158177
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.23972727573551
Log2 mRNA fold difference:-0.29062584227096
Log2 TE fold difference:0.12415931282873
Sequences
Protein sequence

MDEFDSGGRSGDRAGAAAAAAAGDDGATPPLPQTVHIGNSPTYRLERKLGKGGFGQVYVG
RRISAPRLSDRNPGSNALEVALKFEHQSSKGCNFGAPYEWQVYNTLSGNHGVPRVHYKGK
QGEFYIMVMDILGPSLWDVWNNNSHSMSVEMVACIGIEAISILEKMHSKGYVHGDVKPEN
FLLGPPGTPEEKKLFLVDLGLATKWKDAGTGHHVEYDQRPDIFRGTVRYASVHAHLGRTG
SRRDDLESLAYTLIFLLRGRLPWQGYQGENKGFLVCKKKMATSPESLCGICPQPFRNFVE
YVVNLKFDEEPNYARCISLFDGIVGPNPDIRPINTDGAQKLVYQVGQKRGRLIVDENDDE
QPKKKIRMGMPATQWISVYNARRPMKQRYHYNVADNRLVQHIQKGNEDGLFISSVASSSN
LWALIMDAGTGFTSQVYELSSYFLHKEWIMEQWERNFYITALAGANNGSSLVIMSRGTQY
AQQSYKVSDTFPFKWINKKWKEGFYVTAMATAGSRWAVVMSRNAGFTSQVVELDFLYPSE
GIHMRWDNGYRITATAATWDQAAFILSIPRRKPTDETQETLRTSAFPSQHVKDKWSNNLY
LASICYGRSVS*

MATSPESLCGICPQPFRDFVEYVVNLKFGEEPNYAKCISLFDGIVGPNPDIRPINTDGAQ
KLIYQVGQKRGRLIVDENDDEQPKKKIRMGMPATQWISVYNARRPMKQRYHYNVADNRLL
QHIQKGNEDGLFISSVASSSNLWALIMDAGTGFTSQVYELSNYFLHKEWIMEQWERNFYI
TALAGANNGSSLVIMSRGTQYAQQSYKVSDTFPFKWINKKWKEGFYVTAMATAGSRWAVV
MSRNAGFTSQVVELDFLYPSEGIHMRWDNGYRITATAATWDQAAFILSIPRRKPSDETQE
TLRTSAFPSQHVKDKWSKNLYLASICYGRSVS*

Other information
Ka divergence:0.026782KaKs divergence:0.463394
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1836Length 2 (bp):999Length divergence:-0.295
MFE 1 (kcal):-606.2MFE 2 (kcal):-307.7MFE divergence-0.327