Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G045398-GRMZM2G018631
Species:maize
Duplication type:WGD
Function (paralog1):RING-H2 finger protein ATL2L
Function (paralog2):RING-H2 finger protein ATL2L

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MTFPLVCYCYAVPRPVAALLKLLHAAVLVFVLLLSFLGLYEFSYDPEDHAPPAINGGRPR
PEAVKRRLPLVEFLELVDSSSSPSSGLGAEPTCRVCLEWLEAKDEVRRLGNCTHAFHTRC
IDRWIDLGEVTCPLCRSHLLPRRRAGLLGMARLG*

MTFPLVCYCNAVPRPVAALFKTIHAAALVVVLVLCFLGLYEFPYDPEDHAPVINGRARGG
RDAPGPEAVKRHLPLVEFLELMVVAPSPSSGAEAAPTCRVCLERLEAADGVRRLGNCAHA
FHARCIDRWIDLGEVTCPLCRSHLLPRRRAGLLGMARLGDG*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):70GC content 2 (%):73GC content divergence:0.021
Length 1 (bp):465Length 2 (bp):486Length divergence:0.022
MFE 1 (kcal):-221.5MFE 2 (kcal):-257.7MFE divergence0.076