Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G045431-GRMZM2G414252
Species:maize
Duplication type:WGD
Function (paralog1):LOC100281267
Function (paralog2):hypothetical protein LOC100217048

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.1108425440162
Log2 mRNA fold difference:-1.2873127005048
Log2 TE fold difference:0.36052428980307
Sequences
Protein sequence

MEFDLLNYSPEAQLELMTTMLQLEQLTALDGHQFPTMAPVSPPISPMQTHHAGHSLSPPP
HMSATTTTTTTGYPEQYTPAAAVYGATATGLEHLQDYVLSPPGGDCGGAAAAHAGSTSPT
SADAMREAIFHIAALQPVEIDPEAVRPPKRRNVRISKDPQSVAARLRRERISERIRTLQR
LVPGGTKMDTASMLDEAIHYVKFLKSQVQSLERAAHRAAALGAAAYPAFHAPWQYALPHG
DM*

MEFDLLNYYSPEEAQLELMNTMLQLEQLTALDGHRQSAMAPASPPISPMQTHHAGPHSFS
PLPHTSTTTTTTATATGYPKKQHAPPRAVYGAATSSGLEHHHLQLQDGGALQAGPSSAAA
ASADAMREAIFRIAALQPVEDQTTTGPEPEAAVRRAPKRRNVRVSKDPQSVAARLRRERI
SERIRALQRLVPGGTKMDTASMLDEAIQYVKFLKSQLQSLQRAAASRHAPWQYALLPHAD
ML*

Other information
Ka divergence:0.484524KaKs divergence:-0.0483508
GC content 1 (%):70GC content 2 (%):70GC content divergence:0
Length 1 (bp):729Length 2 (bp):729Length divergence:0
MFE 1 (kcal):-372.04MFE 2 (kcal):-353.9MFE divergence-0.025