Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G045433-GRMZM2G091397
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274306
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.88874281493888
Log2 mRNA fold difference:-0.4605066372776
Log2 TE fold difference:-0.43755151299298
Sequences
Protein sequence

MPSVGVKIYSVFFKLFLRHRLQSLAAAAAGDPDNAAFGVSCRPDEATAPPNPAFSAAADG
VASKDLHIDPNSSLSVRIFLPTPPPPSPHAHLLAHAHPRRASDPTPTTPAPAPANGAPYR
GYLPHAVSSPRAAASARRRLPIVVQFHGGGFVTGSNTAAANDAFCRRVAKLCDAIVVAVG
YRLAPESRYPAAFDDGVKVLKWIAKQANLAMMTKVGGGVDTFGASTVEPWIAAHGDPARC
VLLGASCGANIADYVTRKVVEDGKPFDPVKVVAQVLMYPFFIGSVPTHSEIRLANSYFYD
KSTCLLAWRLFLSEKEFNLDHPAANPLAPSRRAPPLKCMPPTLTVIAEHDWMRDRAIAYS
EELRKVNVDSPVLDYKDTVHEFATLDVFLKTPQAQACAEDIAIWMKKYISLRGHEFSY*

MPSVGVKIYSVFFKLLLRHRLQSLASAGGLDNAAFGVSCRPDEATAPPNPAFSAAADGVA
SKDLHIDPNSSLSVRIFLPTPPPPHAHPRRASDPTPTAPAAGAPYRGYLPHAVASPRAAA
SARRRLPIVVQFHGGGFVTGSNTAAANDAFCRRVAKLCDAIVVAVGYRLAPESRYPAAFE
DGVKVLKWITKQANLAMMTKVRGGVDTFGASTVEPWIAAHGDPARCVLLGASCGANIADY
VTRKVVEDGKPFDPVKVVAQVLMYPFFIGSVPTHSEIRLANSYFYDKSTCLLAWRLFLSD
KEFNLDHPAANPLAPGRGGPPLKCMPPTLTVIAEHDWMRDRAIAYSEELRKVNVDSPVLD
YKDTVHEFATLDVFLKTPQAQACAEDIAIWMKKYISLRGHEFSY*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):61GC content 2 (%):59GC content divergence:-0.017
Length 1 (bp):1257Length 2 (bp):1215Length divergence:-0.017
MFE 1 (kcal):-486.6MFE 2 (kcal):-482.04MFE divergence-0.005