Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G045544-GRMZM2G411032
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):DNA binding protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.31126294096687
Log2 mRNA fold difference:1.0533430988898
Log2 TE fold difference:-0.73981937426381
Sequences
Protein sequence

MGDAPAAAAAASPACAAQKRRRGDDGAGLRRVAEIVMVLAAAGEVRGGMEPTAAERALAA
EARETLAAAVAEGAVRPKDLFSVEAVRAVVEDLGLNRAKDPAAMGFRPPKASIADRLMLT
KRKMEEVKEAPVQSTVSAPQTVVSSGMSDFHGLNGATKFGVGVPRDPPVPSITASAPLTS
TSPATLKPPESFPVKPVSNSSVVPVLYSGPSNLKSDKNVSGPLNLAHTGATVVHSNKSTV
DASARSSVNASNQMVKNQDTKPVTVQAMAGNPATGHRATPTFINHNEIAKNVQQFLHQPA
NNPSWTPPSTDYMHSRLSCQICKVVIIGTDSLLVCDACERGVHLKCLQQYGNKGVPKAEW
HCSACLTQSKGKPLPPKYGKVTRTVVASKAAPPGGGAQLSLQGSAENMASKENHQKLAAN
GNLMKPISIQGGSTAPNSNVLALSAITAGSQSQLVSTLRPSRVVKAEMFSIGKEGTGQPC
NTTIQPAVRSSPLNKRLRSDSSLNPADSANDIMHGKYTTEISGAEAKVKSEVNYEASVSR
DEELVDSSGTSIETEQTKVGASEEKPRTQSTFETDKVKDGGTTTNTGTATDQCSNFGTEE
NLPGEITSEAHKITDVKMTSNTGTSVQQSNIDSIEEKASQIDAVSDPHAHIIQDMGMDTN
NGPPVAESGSPVAEEKPPEQSSSIGDVCVTANAGIPTDQTQHPNGSTENVVRKSPNRELY
EEKSGRL*

MGDAATAAAAAAASPACAARKRRRGDDSAGLRRVAEIVMVLAAAGEVRGGRQPTAAERAL
AAEARETLATAVAERAVRPKDLFPGEAVRAVVEDLGLNRSKDPAAMGFRPPKASIADRLM
LTKRKVLPTLSFAPIPAQFTSHCGGFEILNWGDKCDMEEVKEAPVVSAPQTVVSSGTSEF
HGLNGATKFGVGVPRNPPVPSLAATGPLTSTSPVTLKPPGSSPVKPVANSSVVPLVNTGP
SNLKLDKNVSGPLNLAFSGATVVHSNKSTLDTSARPDVNAVQSSNQTVKNHDTKPVAVQA
ATGNPVMGHRATPGVAFAPPKPTFINHNEIAKNVLQFLHQPANHPSWTPPSTEYMHSRLC
CQICKVDIIGTDNLLVCDACERGVHLKCLHQYGNKGVPKAEWHCSACLTQSKGKPLPPKY
GKVTRTVVASKTAPPGGGAQLSLQESAENMAAKENHQKLAANGNLMKPFSIHGGSTVPDS
NVLALSAVMAGSQSQLVSTLRPSIVVKAETPSNGKEGTGQPCNTAIQPNVRSSSLNNRLR
SDSCLNPADSANEIMHGKHAAEISGVEAKVKSEANSEVVVSTDEELVHSSGTSIETERAK
VVAIEENRAQSTFETDKMKVGETTINTGTTDQCINTEEKLPSLATSEAHTITDVKMTSNT
GIPVQQHNIATIEEKTQIDAVSDPHPHAIQDIQDMEMGTNNGPPIDQTSSLVEENPPGQS
SSIADACVTANTGIPTDQTQHPNESTENAVKKSPNRELYKEKPGCNITSDITQKVTSNGI
MCPEDKTLCVHEDKAVGCDTEAKEEN*

Other information
Ka divergence:-0.100206KaKs divergence:-0.318705
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):2184Length 2 (bp):2421Length divergence:0.051
MFE 1 (kcal):-746.66MFE 2 (kcal):-817.15MFE divergence0.045